DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BMP2 and scw

DIOPT Version :9

Sequence 1:NP_001191.1 Gene:BMP2 / 650 HGNCID:1069 Length:396 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:408 Identity:98/408 - (24%)
Similarity:164/408 - (40%) Gaps:106/408 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    50 LSEFELRLLSMFGLKQRP----TPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAA------- 103
            ||| ::.::.:..|..||    .|:.......::|::|...|.........|:..:.:       
  Fly    36 LSE-QMEMIDILDLGDRPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILI 99

Human   104 --------SRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDA 160
                    :..|::.:|......|:|   ..:......||.:.:|.:..:..|.|:::::..   
  Fly   100 SNEDRQEIASCNSILTFSSRLKPEQL---DNELDMHITFNTNDVPVDLSLVQAMLRIYKQPS--- 158

Human   161 LGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTR---------LVNQNASR--WESFDVTPAVM 214
                            :....||....|.|.||.|         .||..:|:  |..|::|..:.
  Fly   159 ----------------LVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLR 207

Human   215 RWTAQGHANHGFVVEVAHLEEKQGVSKRH-VRIS----------RSLHQDEHSWSQIRPLLVTFG 268
            .|.                 ..:|:.:|: :|||          ..|...:.|.:.:.|.:|  |
  Fly   208 YWL-----------------HNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEPFIV--G 253

Human   269 HDGKGHPLHKREKRQAKHKQRKRL-------------------KSSCKRHPLYVDFSDVGWNDWI 314
            :......|.|.:|.:.|....||.                   ..||:|....|||.::..::|:
  Fly   254 YFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWV 318

Human   315 VAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISML-YLDENE 378
            :||..:.|::|.|.|.|||...:|:|||||||||::.....:||.|||||.|.||::| ||  ||
  Fly   319 IAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHLPKPCCVPTVLGAITILRYL--NE 381

Human   379 KVV-LKNYQDMVVEGCGC 395
            .:: |..||..|.:.|||
  Fly   382 DIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BMP2NP_001191.1 TGFb_propeptide 37..267 CDD:279078 43/257 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..121 5/51 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..293 6/40 (15%)
TGFB 296..396 CDD:214556 47/102 (46%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 40/255 (16%)
TGFB 300..400 CDD:214556 47/102 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.