DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPS15 and MRPS28

DIOPT Version :9

Sequence 1:NP_112570.2 Gene:MRPS15 / 64960 HGNCID:14504 Length:257 Species:Homo sapiens
Sequence 2:NP_010624.3 Gene:MRPS28 / 851937 SGDID:S000002745 Length:286 Species:Saccharomyces cerevisiae


Alignment Length:236 Identity:61/236 - (25%)
Similarity:107/236 - (45%) Gaps:33/236 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    15 RAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRK------PAQSRLDDDPPPSTLL 73
            :|.|..:.|.|   |.|..||....:......|..::||.:.:      ..:|...:....|.|.
Yeast    58 KASTDKVDPVL---GRADTPFITRIMAELKEPLVLSKGYNIEEVDKFLAAIESAKRERAELSGLN 119

Human    74 KDYQNVPGIEKVDD---VVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVK 135
            .:...:..|||::|   .:.|:||:..:..|..:|:..|...|:....|.||.|.|.:...::|:
Yeast   120 TEVVGIEDIEKLEDRREAILRILSMRNSENKNAIKMAVELARKEFERFPGDTGSSEVQAACMTVR 184

Human   136 IRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICW---GLGI-------EYT 190
            |::...|:::||||.|:.|.|.:.:.||:.:|:.|:..|.   ||..|   .||:       |:.
Yeast   185 IQNMANHIKEHRKDFANTRNLRILVQQRQAILRYLKRDNP---EKYYWTIQKLGLNDAAITDEFN 246

Human   191 FPPLYYRRAHRRFVTKKALCIR-----VFQETQKLKKRRRA 226
            ....|.:  ...|...|.| ||     ..|:.::::|::||
Yeast   247 MDRRYMQ--DYEFFGDKIL-IRDSKKVANQKRKEIRKQKRA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPS15NP_112570.2 Ribosomal_S15 112..187 CDD:395247 25/77 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..257 2/2 (100%)
MRPS28NP_010624.3 Ribosomal_S15 161..236 CDD:395247 25/77 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C159046464
Domainoid 1 1.000 45 1.000 Domainoid score I3487
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003129
OrthoInspector 1 1.000 - - oto145109
orthoMCL 1 0.900 - - OOG6_101240
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1262
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.630

Return to query results.
Submit another query.