DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPS15 and bonsai

DIOPT Version :9

Sequence 1:NP_112570.2 Gene:MRPS15 / 64960 HGNCID:14504 Length:257 Species:Homo sapiens
Sequence 2:NP_611691.1 Gene:bonsai / 37587 FlyBaseID:FBgn0026261 Length:280 Species:Drosophila melanogaster


Alignment Length:169 Identity:57/169 - (33%)
Similarity:89/169 - (52%) Gaps:19/169 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    57 KPAQS-RLDDDPP--PSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEML--KIKQEQFMKKIV 116
            ||.:| .|...||  ...||.:|::...::|.|:.||.|..|  :|....|  |..:::.:|::.
  Fly    39 KPEKSGDLAKLPPLKADELLPEYRDCKELDKADESVKSLFKL--SNNASYLTTKFYRDEMVKEVQ 101

Human   117 ANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKI 181
            .:.:|..|:||::..::..||.|:||::||.:||..|..|...||:|||.||.||..:|..||.|
  Fly   102 RHAQDFGSMEAKLAKMTAVIRRYQEHMDKHPRDKMIKVRLKELIDKRKKFLKYLRRWDYPRFEWI 166

Human   182 CWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKL 220
            ...|.:.|..||     .|..::|:|       :..|||
  Fly   167 LEKLDLVYKPPP-----THFHWITRK-------ESLQKL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPS15NP_112570.2 Ribosomal_S15 112..187 CDD:395247 30/74 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..257
bonsaiNP_611691.1 Ribosomal_S15 97..172 CDD:278728 30/74 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143583
Domainoid 1 1.000 58 1.000 Domainoid score I10837
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1539741at2759
OrthoFinder 1 1.000 - - FOG0003129
OrthoInspector 1 1.000 - - oto90353
orthoMCL 1 0.900 - - OOG6_101240
Panther 1 1.100 - - LDO PTHR46685
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1262
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.740

Return to query results.
Submit another query.