DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPS15 and Mrps15

DIOPT Version :9

Sequence 1:NP_112570.2 Gene:MRPS15 / 64960 HGNCID:14504 Length:257 Species:Homo sapiens
Sequence 2:NP_001007654.1 Gene:Mrps15 / 298517 RGDID:1359675 Length:257 Species:Rattus norvegicus


Alignment Length:258 Identity:164/258 - (63%)
Similarity:203/258 - (78%) Gaps:3/258 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDD 65
            |||.|||.||.:|.:||||..||.|....||..|..:.|||..| ||.|||.|.|:||.|::.||
  Rat     1 MLRAAWRALSSVRVQAVTQAPVPALRARSSASLPSARCGLQTPS-LLNAARAYAVQKPVQAKQDD 64

Human    66 DPPPSTLLKDYQN-VPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARI 129
            :|..||.:|:|:| :|.:|||||||||:||||||::||.||||:||.|.||..||||.|:|||||
  Rat    65 EPASSTFIKEYKNIIPNMEKVDDVVKRILSLEMASRKEKLKIKREQLMNKIAENPEDYRTLEARI 129

Human   130 IALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPL 194
            :||:||||:||||::||||||.|||:||||||||||.|:.||.||||||||.|..||:||..|||
  Rat   130 VALTVKIRNYEEHMQKHRKDKVHKRHLLMSIDQRKKFLRLLRQTNYDVFEKTCKELGVEYALPPL 194

Human   195 YYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKR-RNPDSPAKAIPKTLKDS 256
            :::|.||||:.||||||:||||.|||||:|.||||||||.|:.|| |.|::|:.|:|:..|::
  Rat   195 HFQRVHRRFLAKKALCIQVFQEVQKLKKQRMALKAAAAAAKKEKRERVPENPSNALPEKTKEN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPS15NP_112570.2 Ribosomal_S15 112..187 CDD:395247 55/74 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..257 17/33 (52%)
Mrps15NP_001007654.1 Ribosomal_S15 112..186 CDD:395247 54/73 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..257 15/28 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83679096
Domainoid 1 1.000 123 1.000 Domainoid score I37761
eggNOG 1 0.900 - - E1_COG0184
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32636
Inparanoid 1 1.050 321 1.000 Inparanoid score I14373
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG36226
OrthoDB 1 1.010 - - D1539741at2759
OrthoFinder 1 1.000 - - FOG0003129
OrthoInspector 1 1.000 - - oto134690
orthoMCL 1 0.900 - - OOG6_101240
Panther 1 1.100 - - LDO PTHR46685
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X8993
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1818.270

Return to query results.
Submit another query.