DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPS15 and mrps-15

DIOPT Version :9

Sequence 1:NP_112570.2 Gene:MRPS15 / 64960 HGNCID:14504 Length:257 Species:Homo sapiens
Sequence 2:NP_492351.1 Gene:mrps-15 / 187087 WormBaseID:WBGene00010624 Length:330 Species:Caenorhabditis elegans


Alignment Length:225 Identity:61/225 - (27%)
Similarity:104/225 - (46%) Gaps:28/225 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    43 RSLLLQAARGYVVRKP--AQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLK 105
            |.|.|:||...::.|.  ...|::    .|.....|:::..:....:.||::.|:|||.:||:.:
 Worm    68 RDLGLKAADNLILEKTEFGLPRIE----KSKTRAKYEDLDVLSNAPESVKKIFSVEMATRKELSQ 128

Human   106 IKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYE---EHLEKHRKDK----AHKRYLLMSIDQR 163
            ..::..:|.:..:..|..|||.:|..|:..||.:.   ..:.:..|.|    .|:.:|:  |::|
 Worm   129 EWKQSLIKSVRQHSLDENSLEMKIAWLTALIRHWSLLVNDIGQETKKKPTWLTHRIWLV--INER 191

Human   164 KKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKA-----LCIRVFQETQKLKKR 223
            :|.|:.||..|...|||....|.|.|..|.   :.||.:  |:||     |.:||  |.:| :||
 Worm   192 RKALRILRERNETAFEKTIAALKISYHVPK---QPAHVK--TRKAWAEAQLKLRV--ENEK-EKR 248

Human   224 RRALKAAAAAQKQAKRRNPDSPAKAIPKTL 253
            ...|......:.:..:|......||:...|
 Worm   249 LEELHEKYDKEVEEHKRETQEKRKALNNEL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPS15NP_112570.2 Ribosomal_S15 112..187 CDD:395247 24/81 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..257 5/29 (17%)
mrps-15NP_492351.1 FAM184 <235..287 CDD:292293 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161451037
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003129
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101240
Panther 1 1.100 - - LDO PTHR46685
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1262
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.