DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIX1 and Six4

DIOPT Version :9

Sequence 1:NP_005973.1 Gene:SIX1 / 6495 HGNCID:10887 Length:284 Species:Homo sapiens
Sequence 2:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster


Alignment Length:255 Identity:126/255 - (49%)
Similarity:153/255 - (60%) Gaps:51/255 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSMLPSF-------GFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAF 58
            ||.:.||       .|:.:|:.|:||.|||.|::|:|..||.|||..:....|||||:|:|:||:
  Fly   166 MSAVSSFPIDAKMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAY 230

Human    59 HRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWD 123
            :.|.|.|||.:||:|.||...|..||.||.||||.||||:||||||||.|||:|:|:|||:||||
  Fly   231 NLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWD 295

Human   124 GEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERE 188
            ||||.||||||||..|::.|..|.||:|.||:.||:.||||.|||||||||||||||        
  Fly   296 GEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDR-------- 352

Human   189 NTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVL---LLQGNMGHARSSN 245
                                            :|.|.||..|||   .|.|| |..|..|
  Fly   353 --------------------------------TPQQRPDIMSVLPVGQLDGN-GFPRMFN 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIX1NP_005973.1 SIX1_SD 9..118 CDD:374862 62/108 (57%)
homeodomain 129..180 CDD:238039 35/50 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..269 26/81 (32%)
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 62/108 (57%)
homeodomain 301..355 CDD:238039 37/93 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.