DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BMP1 and CG11836

DIOPT Version :9

Sequence 1:NP_006120.1 Gene:BMP1 / 649 HGNCID:1067 Length:986 Species:Homo sapiens
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:280 Identity:52/280 - (18%)
Similarity:84/280 - (30%) Gaps:79/280 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   493 LEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLW--LKFVSDGSINKAGFAVNFFKEVDECSRPN 555
            ||...|.:||..:...:.|:.     |.||..|:  :..:|.|..|..|.: :...||:.....:
  Fly    22 LEYSKGFNESDAINTIHTGHN-----KRTSKFLFDTIFRISSGVSNAFGLS-DTEDEVEYTENSS 80

Human   556 RGGCEQRC----------------LNTL---------GSYKCSCDPGYELAPDKRRCEAACGGFL 595
            ...|:..|                :|..         |.:.|.   |..|..|.....|.|...|
  Fly    81 LKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCG---GSLLTKDYVLSAAHCVKKL 142

Human   596 TKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSK 660
            .|....:......:|.......|.:.|.......|...|   |..||:.   .:.:|..::. ||
  Fly   143 RKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPD---TYNNDIA---LLRLRKPISF-SK 200

Human   661 LHGKFC-----------------------GSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFS 702
            :....|                       |.|.|.::    |.::|...|......:.:|:...:
  Fly   201 IIKPICLPRYNYDPAGRIGTVVGWGRTSEGGELPSIV----NQVKVPIMSITECRNQRYKSTRIT 261

Human   703 DK---------DECSKDNGG 713
            ..         |.|..|:||
  Fly   262 SSMLCAGRPSMDSCQGDSGG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BMP1NP_006120.1 ZnMc_BMP1_TLD 121..320 CDD:239808
Astacin 128..321 CDD:279708
CUB 322..431 CDD:278839
CUB 435..544 CDD:278839 14/52 (27%)
FXa_inhibition 555..587 CDD:291342 8/56 (14%)
CUB 591..700 CDD:278839 22/131 (17%)
FXa_inhibition 707..742 CDD:291342 4/7 (57%)
CUB 747..856 CDD:278839
CUB 860..973 CDD:278839
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 34/199 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.