DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BMP1 and CG6763

DIOPT Version :9

Sequence 1:NP_006120.1 Gene:BMP1 / 649 HGNCID:1067 Length:986 Species:Homo sapiens
Sequence 2:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster


Alignment Length:313 Identity:86/313 - (27%)
Similarity:128/313 - (40%) Gaps:71/313 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    11 LGLLLLPRPGRPLD---LADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAV 72
            ||..|..:|...|.   :.:::.|..|.:..|..:|.:        ||:.:.:.||         
  Fly    57 LGTALFGKPDEELTANRVGNFSADADEMNPEELGSYLE--------GDMLVPQTDL--------- 104

Human    73 DLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPF 137
                                     ...||.|.:                :||    ||:||:|:
  Fly   105 -------------------------IMKNGLPTQ----------------SSR----WPNGVVPY 124

Human   138 VIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIG 202
            .|.|||.....|....|:..:.:.||:.|::|:.|..||.......||.|.|||.||..:.....
  Fly   125 EIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQS 189

Human   203 KNC-DKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDF 266
            ..| .:.|..:|||.|.:||.||..|.:||.:|:|...|:|.....||.|  ....|:.|..||:
  Fly   190 PGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEK--AARTEAFGVPYDY 252

Human   267 DSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKC 319
            .|:|||::|.||  |.....:...:.||. ..:|||...|..||.:..::|.|
  Fly   253 GSVMHYSKNAFS--INGQPTILAMQANGA-DKMGQRNGFSDYDIQKLNRMYDC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BMP1NP_006120.1 ZnMc_BMP1_TLD 121..320 CDD:239808 70/200 (35%)
Astacin 128..321 CDD:279708 68/193 (35%)
CUB 322..431 CDD:278839
CUB 435..544 CDD:278839
FXa_inhibition 555..587 CDD:291342
CUB 591..700 CDD:278839
FXa_inhibition 707..742 CDD:291342
CUB 747..856 CDD:278839
CUB 860..973 CDD:278839
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 69/196 (35%)
ZnMc_astacin_like 119..300 CDD:239807 64/185 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.