DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BMP1 and Sb

DIOPT Version :9

Sequence 1:NP_006120.1 Gene:BMP1 / 649 HGNCID:1067 Length:986 Species:Homo sapiens
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:293 Identity:63/293 - (21%)
Similarity:88/293 - (30%) Gaps:118/293 - (40%)


- Green bases have known domain annotations that are detailed below.


Human   752 TSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAP 816
            :|:||.:||...|              :.|.||.            |..|...:|..:..|:..|
  Fly   476 SSSSGIVTSSQRP--------------TQPTHRT------------PVLATSGIETNEISDSSIP 514

Human   817 VLGRF------------CG---SKKPEPVLATG-SRMFLRFYSDNSVQRK---GFQASHATECGG 862
            ..|..            ||   ..:||..:..| |..|.|:....||:|.   ||.::|  .|||
  Fly   515 DAGALGHVKTISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTH--RCGG 577

Human   863 ---------------------QVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELV- 905
                                 |:|..|...| :||.|            |.:...|.|...::| 
  Fly   578 ALINENWIATAGHCVDDLLISQIRIRVGEYD-FSHVQ------------EQLPYIERGVAKKVVH 629

Human   906 ----FQTFEVE---------------------EETDCGYDYMELFDGYDSTAPRLGRYCGSGPPE 945
                |.|:|.:                     .|||      .|..|.::|....||....|...
  Fly   630 PKYSFLTYEYDLALVKLEQPLEFAPHVSPICLPETD------SLLIGMNATVTGWGRLSEGGTLP 688

Human   946 EVYSAGDSVLVKFHSDDTITKKGFHLRYTSTKF 978
            .|.   ..|.|...|:|..  |...:|....:|
  Fly   689 SVL---QEVSVPIVSNDNC--KSMFMRAGRQEF 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BMP1NP_006120.1 ZnMc_BMP1_TLD 121..320 CDD:239808
Astacin 128..321 CDD:279708
CUB 322..431 CDD:278839
CUB 435..544 CDD:278839
FXa_inhibition 555..587 CDD:291342
CUB 591..700 CDD:278839
FXa_inhibition 707..742 CDD:291342
CUB 747..856 CDD:278839 28/122 (23%)
CUB 860..973 CDD:278839 32/159 (20%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 44/200 (22%)
Tryp_SPc 544..785 CDD:238113 44/199 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.