DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment BMP1 and CG4914

DIOPT Version :9

Sequence 1:	NP_006120.1	Gene:	BMP1 / 649	HGNCID:	1067	Length:	986	Species:	Homo sapiens
Sequence 2:	NP_648711.1	Gene:	CG4914 / 39597	FlyBaseID:	FBgn0036436	Length:	374	Species:	Drosophila melanogaster

Alignment Length:	176	Identity:	35/176 - (19%)
Similarity:	48/176 - (27%)	Gaps:	84/176 - (47%)

- Green bases have known domain annotations that are detailed below.

Human   745 AGCDHKVTSTSGTITSPNWP--DKYPSKKECTWAISSTPG---------HRV-KLTFMEMDIESQ 797
            |.|.....:||.|..:|..|  ...|:....|.::||.||         |:. ||...:::..|.
  Fly    16 ASCLLFTAATSATPATPATPATSAPPATSTATSSLSSIPGKYQALGAAHHQAKKLKIGDVNASSS 80

Human   798 PECAYDHLEVFDGRDAKAPV---------LGRF-------------------CGSKKPEPVLATG 834
                          ||..||         .|.|                   ||.:..|..:..|
  Fly    81 --------------DANKPVFRQNPIKNWFGAFNRNNSPAAQNQTSPTCSCRCGERNDESRIVGG 131

Human   835 S-------------RMFLRFYSDNSVQRKGFQASHATECGGQVRAD 867
            :             ..|.|||                 |||.:..|
  Fly   132 TTTGVSEYPWMARLSYFNRFY-----------------CGGTLIND 160

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
BMP1	NP_006120.1	ZnMc_BMP1_TLD	121..320	CDD:239808
		Astacin	128..321	CDD:279708
		CUB	322..431	CDD:278839
		CUB	435..544	CDD:278839
		FXa_inhibition	555..587	CDD:291342
		CUB	591..700	CDD:278839
		FXa_inhibition	707..742	CDD:291342
		CUB	747..856	CDD:278839	30/161 (19%)
		CUB	860..973	CDD:278839	4/8 (50%)
CG4914	NP_648711.1	Tryp_SPc	127..360	CDD:214473	9/51 (18%)
CG4914	NP_648711.1	Tryp_SPc	128..363	CDD:238113	9/50 (18%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910