DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BMP1 and CG42255

DIOPT Version :9

Sequence 1:NP_006120.1 Gene:BMP1 / 649 HGNCID:1067 Length:986 Species:Homo sapiens
Sequence 2:NP_729748.3 Gene:CG42255 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster


Alignment Length:999 Identity:223/999 - (22%)
Similarity:364/999 - (36%) Gaps:279/999 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    12 GLLLLPR-PGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLR 75
            |::..|. ||...|....||:|     :.||:.....:........|.:|.|.....|..:.|.:
  Fly   866 GIISTPNYPGPYFDDMTCTYNL-----TGPLDTAVRMRITDLSLGTANNENDTSYLDVYLSADQK 925

Human    76 RHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIG 140
            ||..:.:.....:                           |.|.||:              .|..
  Fly   926 RHIVKSTDNLILL---------------------------SHSNRAS--------------LVFH 949

Human   141 GNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNC 205
            |:..|       :.||                   :.:.:.|..|..::...|........|..|
  Fly   950 GSGGG-------RGMR-------------------LEYNFVPNQCGGFLNEPGRRYVTAVRGTFC 988

Human   206 DKF-------GIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGET 263
            ..|       .|.:|.||....             :||...:..||:..|...      .|:|:.
  Fly   989 QWFIDFPGRKKISIHTLGPTPS-------------ISIYDNSTSPGKLVNSYS------GSVGDV 1034

Human   264 YDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQD 328
            :|.|.:.          |.|.|..|:.|:..::..|.|:                 .:||.|...
  Fly  1035 FDGDLLT----------INLHTNWPRLEIYSIQFDIVQQ-----------------DSCGGTFTA 1072

Human   329 STGNFSSPEYPNGYSAHMHCVWRISVTPGEKIIL---NFTSLDLYRSRLCWYDYVEVRDGFWRKA 390
            ..|...||.:|..|.....|.|.:....|.:|.|   |||..:.|.|..||.|::|:|:|....:
  Fly  1073 RFGYIKSPNWPKNYGESQMCEWILRAPFGHRIELVVHNFTLEEEYSSTGCWTDWLEIRNGDSESS 1137

Human   391 PLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYE---AICGGDVKKDYGHIQSPNYP 452
            ||.||:||:::|..|.|..:.|.::|:|..:...|||...::   |.|||.:....|.|.||:..
  Fly  1138 PLIGRYCGNEIPSRIPSFGNVLHLKFKSDDSMEEKGFLLSWQQMGAGCGGKLSSSMGTIHSPHLL 1202

Human   453 DDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDS--CAYDYLEVRDGHSESSTLIGRYCGYEKP 515
            ...|....|.|:|.|:||..|.|..:|     :|:  |: ..|.:.||.:.:|..|...|.....
  Fly  1203 AGNRGILACDWQIIVAEGSRVSLQLRS-----NDNRICS-GQLTLYDGPTTASNPIVIRCNGTIA 1261

Human   516 DDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYEL 580
            ..::||.:|:.:::                                             |.|:: 
  Fly  1262 KPLQSTGNRVLVRY---------------------------------------------DVGHD- 1280

Human   581 APD--------KRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVA-PTQYRISLQFDFF 636
            |||        :..|.....|    |.|:|.:|.:|:.|||.::|.|.:.| ..:..:.|.|...
  Fly  1281 APDGTDFMLNYQTNCRVRLEG----LQGAIETPNFPENYPPGQDCEWDIRAGGRKNHLQLIFSHL 1341

Human   637 ETEG-NDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHF 700
            ..|. :.:|..|:|.:...|...:......|.::..|.||:..|.:.:.||||::|..:||:|.:
  Fly  1342 SVEKFSSICLNDYVSLVDMLDDQTLSEQHLCTNDGLEPITTVGNRLLLRFKSDSSVELQGFRAEY 1406

Human   701 FSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPD 765
                                                      |..||...:..:.|...|||.| 
  Fly  1407 ------------------------------------------KRIGCGEHLRESGGRFESPNAP- 1428

Human   766 KYPSKKECTWAISSTPGHRVKLTFMEMDIES-QPECAYDHLEVFDGRDAK------AP------- 816
             :....:|.|.|:::.|::::|...|:..|: |.||          |||:      ||       
  Fly  1429 -FSVDMDCVWIITASEGNQIRLLLHEVYFEAPQIEC----------RDAESSLSVSAPSGYNSSV 1482

Human   817 VLGRFCGSK-KPEPVLATGSRMFLRFYSDNSVQRKGFQASHA---TECGGQVRAD---VKTKDLY 874
            ||.|.|..: :.:...:.|:.:.:||.|.::..||.|:||..   ..|||.:.|.   :.|...:
  Fly  1483 VLFRSCHEETQTQTFTSPGNELVIRFVSSSAPSRKYFKASFVQVPASCGGYISASSGVLTTPGFH 1547

Human   875 SHAQFGDN--NYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYMELFD-GYDSTAPRLG 936
            :| |...|  ||...::|.|.:....|||:...|:.|.:.:..:|...::||.. ..|:....|.
  Fly  1548 NH-QDSKNVANYTSNIECVWTVEVTNGYGIRPHFEQFNLTDSGNCSVSFVELTKLEPDNKEIFLE 1611

Human   937 RYCGSGPPEEVYSAGDSVLVKFHS 960
            :.||...|......|..:.|:|.|
  Fly  1612 KTCGEDSPMIRIVHGRKLRVRFKS 1635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BMP1NP_006120.1 ZnMc_BMP1_TLD 121..320 CDD:239808 32/205 (16%)
Astacin 128..321 CDD:279708 31/199 (16%)
CUB 322..431 CDD:278839 39/111 (35%)
CUB 435..544 CDD:278839 28/110 (25%)
FXa_inhibition 555..587 CDD:291342 5/39 (13%)
CUB 591..700 CDD:278839 32/110 (29%)
FXa_inhibition 707..742 CDD:291342 0/34 (0%)
CUB 747..856 CDD:278839 33/123 (27%)
CUB 860..973 CDD:278839 29/107 (27%)
CG42255NP_729748.3 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:278437
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001
CUB 857..963 CDD:238001 26/168 (15%)
CUB 1066..1179 CDD:238001 39/112 (35%)
CUB 1185..1293 CDD:238001 33/159 (21%)
CUB 1303..1406 CDD:238001 30/102 (29%)
CUB 1411..1523 CDD:238001 33/123 (27%)
CUB 1530..1648 CDD:238001 29/107 (27%)
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2096..2193 CDD:294042
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:294042
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:294042
CUB 3499..3607 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.