DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BMP1 and tpr

DIOPT Version :9

Sequence 1:NP_006120.1 Gene:BMP1 / 649 HGNCID:1067 Length:986 Species:Homo sapiens
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:301 Identity:68/301 - (22%)
Similarity:83/301 - (27%) Gaps:123/301 - (40%)


- Green bases have known domain annotations that are detailed below.


Human   553 RPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNC 617
            ||.....|...|.||.|.....|     |..............|......|:|..|...|| :||
  Fly    55 RPGSSDSENATLATLSSSSMMPD-----AASTTSTTTPAPSSSTTTTRRATTPAPPTLNPP-RNC 113

Human   618 IWQL--VAPTQYRI---------------------------SLQFDFFETEGNDVCKYDF----V 649
            ...:  :|..|.||                           ||..|.|....:. |.|.|    :
  Fly   114 SDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASH-CVYGFRKERI 177

Human   650 EVRSGLTADSKL-HGKFCGSEKPEVITSQYNNMR--------------VE--------------- 684
            .||. |..|.|: |.:....:..||||....|.|              ||               
  Fly   178 SVRL-LEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGR 241

Human   685 -FKSDNTV------SKKGFKAHFFSD-----------KDECSK--------DN---GGCQQDCVN 720
             ||.:|.:      .|.|...   ||           :|||.|        ||   ||..:.   
  Fly   242 SFKGENGIVTGWGALKVGGPT---SDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEG--- 300

Human   721 TFGSYECQCRSGFVLH-----DNKHD----------CKEAG 746
              |...||..||..||     ..:|.          |.:||
  Fly   301 --GKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BMP1NP_006120.1 ZnMc_BMP1_TLD 121..320 CDD:239808
Astacin 128..321 CDD:279708
CUB 322..431 CDD:278839
CUB 435..544 CDD:278839
FXa_inhibition 555..587 CDD:291342 7/31 (23%)
CUB 591..700 CDD:278839 38/178 (21%)
FXa_inhibition 707..742 CDD:291342 14/60 (23%)
CUB 747..856 CDD:278839 68/301 (23%)
CUB 860..973 CDD:278839
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 49/224 (22%)
Tryp_SPc 127..356 CDD:238113 48/223 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.