Sequence 1: | NP_006120.1 | Gene: | BMP1 / 649 | HGNCID: | 1067 | Length: | 986 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611611.1 | Gene: | tpr / 37486 | FlyBaseID: | FBgn0034661 | Length: | 372 | Species: | Drosophila melanogaster |
Alignment Length: | 301 | Identity: | 68/301 - (22%) |
---|---|---|---|
Similarity: | 83/301 - (27%) | Gaps: | 123/301 - (40%) |
- Green bases have known domain annotations that are detailed below.
Human 553 RPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNC 617
Human 618 IWQL--VAPTQYRI---------------------------SLQFDFFETEGNDVCKYDF----V 649
Human 650 EVRSGLTADSKL-HGKFCGSEKPEVITSQYNNMR--------------VE--------------- 684
Human 685 -FKSDNTV------SKKGFKAHFFSD-----------KDECSK--------DN---GGCQQDCVN 720
Human 721 TFGSYECQCRSGFVLH-----DNKHD----------CKEAG 746 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BMP1 | NP_006120.1 | ZnMc_BMP1_TLD | 121..320 | CDD:239808 | |
Astacin | 128..321 | CDD:279708 | |||
CUB | 322..431 | CDD:278839 | |||
CUB | 435..544 | CDD:278839 | |||
FXa_inhibition | 555..587 | CDD:291342 | 7/31 (23%) | ||
CUB | 591..700 | CDD:278839 | 38/178 (21%) | ||
FXa_inhibition | 707..742 | CDD:291342 | 14/60 (23%) | ||
CUB | 747..856 | CDD:278839 | 68/301 (23%) | ||
CUB | 860..973 | CDD:278839 | |||
tpr | NP_611611.1 | Tryp_SPc | 126..354 | CDD:214473 | 49/224 (22%) |
Tryp_SPc | 127..356 | CDD:238113 | 48/223 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |