DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BMP1 and CG8170

DIOPT Version :9

Sequence 1:NP_006120.1 Gene:BMP1 / 649 HGNCID:1067 Length:986 Species:Homo sapiens
Sequence 2:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster


Alignment Length:719 Identity:133/719 - (18%)
Similarity:205/719 - (28%) Gaps:245/719 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   200 SIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVE--SLGE 262
            ::|...|....|.||.|                 ..:..:...|.|....|::.|:..|  .|..
  Fly   204 ALGPPADGVAAVAHEFG-----------------ADLATQGSGPEQPPLALELGPERTERSDLMA 251

Human   263 TYDFDSIMHYA--RNTFSR-------------------------GIFLDTIVPKYE-------VN 293
            .......:.||  .||..|                         .||.||....||       .:
  Fly   252 AASSTDKLEYAEPENTSRRVGFQFPSYSLKPASPFHPQAYREDNPIFGDTSAGGYEPQPYSEDAS 316

Human   294 GVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYP---NGYSAHMHCVWRISVT 355
            .|.||    |:..:.:....|:||         .||....||.|:|   :....|...::|..||
  Fly   317 PVPPP----TQYEQHETRHTRQLY---------FDSDTASSSFEFPGLVSNSKPHGLKLYRDDVT 368

Human   356 PGEKIILNFTSLDLYR-SRLCWYDYVEVRDGFWRKAPLR----------------------GRFC 397
            ....|....|:|...| .|..::...|.|.|  ..||:|                      .|:.
  Fly   369 KFGDINGPITALPQQRPQRGFYFGDTEFRTG--PPAPVRQFGPQKNFQEYVGPSEYQGTRKSRYY 431

Human   398 ---GSKLPEPIVSTDSRLWVEFRS----SSNWVGKGF------------FAVYEAICGGDVKKDY 443
               .|:.|..:..|:..:.....|    ||...|.|.            |.:.|.....||:.||
  Fly   432 PYKSSRSPRVVFPTNDNVGTTGPSGPAGSSGPSGNGVYFSDNIAFRDQNFGINELAAVQDVRNDY 496

Human   444 GHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSE------- 501
            . :|..:...:...|.      |.:..|.     :..:|.....|.:     |.|..|       
  Fly   497 S-LQDLDSASEATSSP------QSASTFK-----EKVDITTDTECQH-----RGGTCEFFLGCWL 544

Human   502 SSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRG--GCEQRCL 564
            |..||...|     |.:.........|..:.||.:..|.||    ::.:..:.|.|  ..|..|.
  Fly   545 SGGLIQGTC-----DGLLRGCCHRTAKSANLGSSDFVGNAV----DLTDLPQKNYGPVNNEPSCG 600

Human   565 NTLGSYKC------SCDPGYELAPDK---RRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQ 620
            .:|.....      ..|.|:...|.:   |...:.|||.|......:|:          .:|:.:
  Fly   601 ISLAKQTAQRRIVGGDDAGFGSFPWQAYIRIGSSRCGGSLISRRHVVTA----------GHCVAR 655

Human   621 LVAPTQYRISLQFDFFETEGNDVCKYDF----VEVR--------------SGLTADSKLH----- 662
             ..|.|..::|......:....:..|.|    ::|.              |.||.:..:|     
  Fly   656 -ATPRQVHVTLGDYVINSAVEPLPAYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHI 719

Human   663 GKFCGSEKPEVITSQYN----------NMRVEFKS---------DNTVSKK-----GFKAHFFSD 703
            ...|..||.|....::.          ..|:..|:         :|.:.::     |.....:.:
  Fly   720 APICLPEKNEDFLGKFGWAAGWGALNPGSRLRPKTLQAVDVPVIENRICERWHRQNGINVVIYQE 784

Human   704 ----------KDECSKDNGGCQQDCVN--------TFGSYECQCRSGFVLHDNKHDCKEAGCDHK 750
                      ||.|..|:||......|        ....|.|..|.            :.|..|.
  Fly   785 MLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRG------------QPGIYHS 837

Human   751 VTST 754
            |:.|
  Fly   838 VSKT 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BMP1NP_006120.1 ZnMc_BMP1_TLD 121..320 CDD:239808 30/155 (19%)
Astacin 128..321 CDD:279708 30/156 (19%)
CUB 322..431 CDD:278839 31/153 (20%)
CUB 435..544 CDD:278839 24/115 (21%)
FXa_inhibition 555..587 CDD:291342 9/42 (21%)
CUB 591..700 CDD:278839 24/155 (15%)
FXa_inhibition 707..742 CDD:291342 8/42 (19%)
CUB 747..856 CDD:278839 3/8 (38%)
CUB 860..973 CDD:278839
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 42/254 (17%)
Tryp_SPc 612..846 CDD:238113 42/253 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.