Sequence 1: | NP_006120.1 | Gene: | BMP1 / 649 | HGNCID: | 1067 | Length: | 986 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285959.1 | Gene: | CG15254 / 34915 | FlyBaseID: | FBgn0028949 | Length: | 254 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 68/196 - (34%) |
---|---|---|---|
Similarity: | 106/196 - (54%) | Gaps: | 8/196 - (4%) |
- Green bases have known domain annotations that are detailed below.
Human 130 WPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLE-RTDEDSYIVFTYRPCGCCSYVGRRG 193
Human 194 G----GPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEP 254
Human 255 QEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKC 319
Human 320 P 320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BMP1 | NP_006120.1 | ZnMc_BMP1_TLD | 121..320 | CDD:239808 | 66/194 (34%) |
Astacin | 128..321 | CDD:279708 | 68/196 (35%) | ||
CUB | 322..431 | CDD:278839 | |||
CUB | 435..544 | CDD:278839 | |||
FXa_inhibition | 555..587 | CDD:291342 | |||
CUB | 591..700 | CDD:278839 | |||
FXa_inhibition | 707..742 | CDD:291342 | |||
CUB | 747..856 | CDD:278839 | |||
CUB | 860..973 | CDD:278839 | |||
CG15254 | NP_001285959.1 | Astacin | 58..251 | CDD:279708 | 66/194 (34%) |
ZnMc_astacin_like | 61..248 | CDD:239807 | 62/189 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3510 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.760 |