Sequence 1: | NP_006120.1 | Gene: | BMP1 / 649 | HGNCID: | 1067 | Length: | 986 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609756.1 | Gene: | Semp1 / 34914 | FlyBaseID: | FBgn0028944 | Length: | 251 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 68/201 - (33%) |
---|---|---|---|
Similarity: | 109/201 - (54%) | Gaps: | 15/201 - (7%) |
- Green bases have known domain annotations that are detailed below.
Human 130 WPDGVIPFVIGGN-FTGSQRAVFRQAMRHWEKHTCVTFLERTDED--SYIVFTYRPCGCCS-YVG 190
Human 191 RRGGGPQAIS-----IGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFL 250
Human 251 KMEPQEV-ESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQAR 314
Human 315 KLYKCP 320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BMP1 | NP_006120.1 | ZnMc_BMP1_TLD | 121..320 | CDD:239808 | 66/199 (33%) |
Astacin | 128..321 | CDD:279708 | 68/201 (34%) | ||
CUB | 322..431 | CDD:278839 | |||
CUB | 435..544 | CDD:278839 | |||
FXa_inhibition | 555..587 | CDD:291342 | |||
CUB | 591..700 | CDD:278839 | |||
FXa_inhibition | 707..742 | CDD:291342 | |||
CUB | 747..856 | CDD:278839 | |||
CUB | 860..973 | CDD:278839 | |||
Semp1 | NP_609756.1 | Astacin | 53..249 | CDD:279708 | 68/201 (34%) |
ZnMc_astacin_like | 55..245 | CDD:239807 | 63/194 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |