| Sequence 1: | NP_006120.1 | Gene: | BMP1 / 649 | HGNCID: | 1067 | Length: | 986 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_609756.1 | Gene: | Semp1 / 34914 | FlyBaseID: | FBgn0028944 | Length: | 251 | Species: | Drosophila melanogaster |
| Alignment Length: | 201 | Identity: | 68/201 - (33%) |
|---|---|---|---|
| Similarity: | 109/201 - (54%) | Gaps: | 15/201 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Human 130 WPDGVIPFVIGGN-FTGSQRAVFRQAMRHWEKHTCVTFLERTDED--SYIVFTYRPCGCCS-YVG 190
Human 191 RRGGGPQAIS-----IGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFL 250
Human 251 KMEPQEV-ESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQAR 314
Human 315 KLYKCP 320 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| BMP1 | NP_006120.1 | ZnMc_BMP1_TLD | 121..320 | CDD:239808 | 66/199 (33%) |
| Astacin | 128..321 | CDD:279708 | 68/201 (34%) | ||
| CUB | 322..431 | CDD:278839 | |||
| CUB | 435..544 | CDD:278839 | |||
| FXa_inhibition | 555..587 | CDD:291342 | |||
| CUB | 591..700 | CDD:278839 | |||
| FXa_inhibition | 707..742 | CDD:291342 | |||
| CUB | 747..856 | CDD:278839 | |||
| CUB | 860..973 | CDD:278839 | |||
| Semp1 | NP_609756.1 | Astacin | 53..249 | CDD:279708 | 68/201 (34%) |
| ZnMc_astacin_like | 55..245 | CDD:239807 | 63/194 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||