DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BMP1 and Cubn

DIOPT Version :9

Sequence 1:NP_006120.1 Gene:BMP1 / 649 HGNCID:1067 Length:986 Species:Homo sapiens
Sequence 2:NP_727348.2 Gene:Cubn / 326235 FlyBaseID:FBgn0052702 Length:3750 Species:Drosophila melanogaster


Alignment Length:966 Identity:224/966 - (23%)
Similarity:350/966 - (36%) Gaps:292/966 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   240 NIQPGQ---EY------------NFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPK 289
            |.:||.   ||            .|.::|...::.| |..|.         |...|..|...:..
  Fly   762 NTEPGGVSCEYEIHLAVGEQVVIQFARLELDPLDCL-EVLDI---------TDEGGSILQEKICG 816

Human   290 YEVNGVKPP--IGQRTRLSKGDIAQARKL---YKCPACGETLQDSTGNFSSPEYPNGYSAHMHCV 349
            .:.:.:.||  ..:..||.....|:|...   |:. ||...|.:..|..:||.|||...:...|.
  Fly   817 SDASRLNPPTFTSEFNRLKIKFYARAGSFQLNY
RM-ACDYKLNNEQGTITSPGYPNLTRSDRICT 880

Human   350 WRISVTPGEKIILNFTSLDLYRSRL-------CWYDYVEVRDGFWRKAPLRGRFCGSKLPEP-IV 406
            :.||......|.|......|.....       |....:.:.||..||  :.|.:||...||. .|
  Fly   881 YTISTATNTVISLKRIDFQLTNGESDDDDNDECLTTNLRINDGLNRK--ILGPYCGKNQPEENFV 943

Human   407 STDSRLWVEFRSSSNWVGKGFFAVYEAI------CGGDVKKDYGHIQSPNYPDDYRPSKVCIWRI 465
            |..:.|.:...:..:.:|:||...|.|:      |||...:...||:.|.:.|.|.....|.|.|
  Fly   944 SETNYLQLHLSTDVDSMGRGFKFEYRA
LATGNDKCGGVHTRSGDHIRLPVHDDSYAGEATCYWVI 1008

Human   466 QVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDG-----HSESSTLIGRYCGYEKPDDIKSTSSRL 525
            .......:.|.:.||.:|....|.|||||:.|.     :.|.|..:.:|||...|:|:.|.|.:|
  Fly  1009 MAPANKAIRLHWNSFSLENAVDCIYDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDLLSHSRQL 1073

Human   526 WLKFVSDGSINKAGFAVNF-FKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEA 589
            .||||||.|.:..||.:.: |::                                        .|
  Fly  1074 VLKFVSDYSESDGGFDLTYTFED----------------------------------------RA 1098

Human   590 ACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSG 654
            .|||.:...:|.:|||.:|..|....:|.|.|.....:.:.:|.:.||.|.:..|..|::|||:|
  Fly  1099 KCGGHIHASSGELTSPEYPANYSAGLDCDWHLTGTIDHLLEIQVENFELEQSPNCSADYLEVRNG 1163

Human   655 LTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFK---------------------- 697
            ...||.|.|:|||.:.|..|....:.||:...:|:.::.:||:                      
  Fly  1164 GGTDSPLIGRFCGRDIPARIPGFSHEMRLILHTDSAINGRGFRLRWRIFAFGCGGSLRSNMGAIS 1228

Human   698 -----------AH----------------------------FFSD---------------KDECS 708
                       ||                            ::..               |..|.
  Fly  1229 SPRYPNSYPNMAHCEWRISLHPGSGISLLIEDLELEGLSNCYYDSVKIYTGIKLPNQSPCKVLCK 1293

Human   709 KD-----------NGGC---QQDCVNTFG----SYECQC-------------------------- 729
            .|           |.|.   ..|..|||.    ||:..|                          
  Fly  1294 DDDLHNPLIQLENNKGTIVFDSDASNTFRGFRISYKANCIRNLTATTGTIESLNYMEPFWETIPI 1358

Human   730 ---------------------------------RSGFVLHDNKH--------------------- 740
                                             ..|..:.|.::                     
  Fly  1359 NCSWTIRAPKGNRVLVEVSHLARHEQHVPTATMPGGLYIVDGRNVQEIVTPQAMNISGEVLTVVH 1423

Human   741 ---------DCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIES 796
                     |.:..||..::..|.|...|||:|..||:..||.|.|:......::||...:|:|.
  Fly  1424 NASNVNFQLDYRIDGCMEELRGTFGFFQSPNYPKMYPNNLECYWLITVEQDSAIELTINNIDLED 1488

Human   797 QPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLRFYSDNSVQRKGFQASHAT--- 858
            .|.|..|.|.|.:.::: ..|..|.|||.....:.::|.|:.:||.||||....||:|::.|   
  Fly  1489 SPNCTKDALTVSNHKNS-VEVHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATYRTVKA 1552

Human   859 ECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEET--DCGYDY 921
            .|||::.|.....:..::..    |||....|||.:...:.:  ::||:..::..|:  ||.:||
  Fly  1553 TCGGKLTARNGVIESPNYPL----NYPAHSRCEWQVEVSQHH--QIVFEMADLNLESGYDCNWDY 1611

Human   922 MELFD--GYDSTAPRLGRYCGSGPPEE--VYSAGDSVLVKFHSDDTITKKGFHLRY 973
            :|.:|  ..|:...||.:.||....::  :.|:.:..:|:|.|||:::||||.|.:
  Fly  1612 LEAYDLTEDDTEGERLFKVCGDETEDDKLLSSSSNMAVVRFISDDSVSKKGFRLHF 1667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BMP1NP_006120.1 ZnMc_BMP1_TLD 121..320 CDD:239808 20/99 (20%)
Astacin 128..321 CDD:279708 20/100 (20%)
CUB 322..431 CDD:278839 30/116 (26%)
CUB 435..544 CDD:278839 41/113 (36%)
FXa_inhibition 555..587 CDD:291342 0/31 (0%)
CUB 591..700 CDD:278839 38/169 (22%)
FXa_inhibition 707..742 CDD:291342 13/141 (9%)
CUB 747..856 CDD:278839 38/108 (35%)
CUB 860..973 CDD:278839 35/118 (30%)
CubnNP_727348.2 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 282..322 CDD:214542
EGF_3 328..366 CDD:289699
EGF 430..457 CDD:278437
EGF_CA 469..503 CDD:238011
CUB 509..622 CDD:238001
CUB 627..737 CDD:238001
CUB 744..849 CDD:294042 19/96 (20%)
CUB 853..970 CDD:238001 31/118 (26%)
CUB 978..1094 CDD:238001 41/115 (36%)
CUB 1100..1211 CDD:238001 36/110 (33%)
CUB 1216..1330 CDD:238001 13/113 (12%)
CUB 1446..1549 CDD:238001 37/103 (36%)
CUB 1554..1667 CDD:238001 35/118 (30%)
CUB 1792..1899 CDD:238001
CUB 1910..1998 CDD:294042
CUB 2019..2133 CDD:238001
CUB 2140..2242 CDD:238001
CUB 2263..2379 CDD:238001
CUB 2385..2511 CDD:238001
CUB 2516..2630 CDD:238001
CUB <2833..2892 CDD:294042
CUB 2898..3008 CDD:238001
CUB 3011..3127 CDD:238001
CUB 3130..3241 CDD:238001
CUB 3254..3363 CDD:238001
CUB 3379..3508 CDD:238001
CUB 3531..3601 CDD:294042
CUB 3623..3733 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.