DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-A2 and AMPD3

DIOPT Version :9

Sequence 1:NP_525020.2 Gene:Adgf-A2 / 64879 FlyBaseID:FBgn0043025 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_000471.1 Gene:AMPD3 / 272 HGNCID:470 Length:776 Species:Homo sapiens


Alignment Length:541 Identity:109/541 - (20%)
Similarity:187/541 - (34%) Gaps:151/541 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VLVLICSAPLGENMSNLTSEERHARLRQIYIEKERRQRLGSRMGLSPLEEEANDRLMAIRQVDEE 122
            :|.||...|        |....|.||..:..:....:.|........|:...:.....:|:||..
Human   270 ILALITDGP--------TKTYCHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTH 326

  Fly   123 FY--------NLWRNYHSQPPPFLKHLNIIDTNLYAALKSMPKGGLLHVHDSGMLRMEILIDLIY 179
            .:        :|.|        |:||....:.:...|.|...|..|..|.|.  |.|: ..||..
Human   327 IHAAACMNQKHLLR--------FIKHTYQTEPDRTVAEKRGRKITLRQVFDG--LHMD-PYDLTV 380

  Fly   180 RDNLWVCVNLEQDFEDF-RFSRYFPHIPPAEDYQCNWMLMSNFFQLESRL--EFENRLRKTLTVR 241
             |:|.|... .|.|..| :|:..:..:..:|       |...:.:.|:.|  |:..|:.|     
Human   381 -DSLDVHAG-RQTFHRFDKFNSKYNPVGASE-------LRDLYLKTENYLGGEYFARMVK----- 431

  Fly   242 PEGYKSSSELARHLRRHQ------RI-IHGLITFRPIWSEFIFTMLS-DFYADGVHYVELRSSLP 298
                    |:||.|...:      |: |:|.....  |....:..:. ..|:..:.::   ..:|
Human   432 --------EVARELEESKYQYSEPRLSIYGRSPEE--WPNLAYWFIQHKVYSPNMRWI---IQVP 483

  Fly   299 NMYDLDGNNFTILETAEALVSVSNIFKNSFKDFIGIKLIYAPSRNLNDSRMDEYLENARLLKLH- 362
            .:||       |..:.:.|.:...:.:|.|..      ::..:.|..|.|           :|| 
Human   484 RIYD-------IFRSKKLLPNFGKMLENIFLP------LFKATINPQDHR-----------ELHL 524

  Fly   363 FPNFFAGFDL---------NTFGDE-----------------------CNLPLLENVTQLLRIGK 395
            |..:..|||.         :.|.|:                       .|:.:|.|    ||..:
Human   525 FLKYVTGFDSVDDESKHSDHMFSDKSPNPDVWTSEQNPPYSYYLYYMYANIMVLNN----LRRER 585

  Fly   396 NID-FYF--HAGESRCPDSSRPDANLLEALLLQSKRIGNAVNLPFHPEIMKVMKRLSIAVEICPL 457
            .:. |.|  |.||:       .....|.:..|.:..|.:.:.|...|.:..:.....|.:.:.||
Human   586 GLSTFLFRPHCGEA-------GSITHLVSAFLTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPL 643

  Fly   458 SNHYLQYFNDFRQHPAAYLIAAGFPIVIGSDYPC--FWNSAPLTDDFYVAFVGVISGWGDLRL-- 518
            ||:.|  |.::.::|....:..|..:.:.:|.|.  .:....|.:::.:|    ...|   :|  
Human   644 SNNSL--FLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIA----AQVW---KLST 699

  Fly   519 --LKQFALNSFLFSSLSETEK 537
              |.:.|.||.|.|.||..||
Human   700 CDLCEIARNSVLQSGLSHQEK 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-A2NP_525020.2 A_deaminase_N 52..152 CDD:285627 18/101 (18%)
adm_rel 83..556 CDD:273620 102/516 (20%)
ADGF 135..548 CDD:238646 94/456 (21%)
AMPD3NP_000471.1 AMP_deaminase 155..762 CDD:273618 109/541 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.