DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-A2 and Ada

DIOPT Version :9

Sequence 1:NP_525020.2 Gene:Adgf-A2 / 64879 FlyBaseID:FBgn0043025 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001258981.1 Gene:Ada / 11486 MGIID:87916 Length:352 Species:Mus musculus


Alignment Length:294 Identity:57/294 - (19%)
Similarity:106/294 - (36%) Gaps:88/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 DGVHYVELRSSLPNMY---DLDGNNFTILE---TAEALVSVSNIFKNSFKDFIGIK-------LI 337
            :||.|||:|.| |::.   .:|...:...|   |.:.:|.:.|......:...|||       :.
Mouse    93 EGVVYVEVRYS-PHLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMR 156

  Fly   338 YAPSRNLN----------------DSRMDEYLENARLLKLHFPNFFAGFDLNTFGDECNLPLLEN 386
            :.||.:|.                |...||.:|.:.|    ||.....::    |          
Mouse   157 HQPSWSLEVLELCKKYNQKTVVAMDLAGDETIEGSSL----FPGHVEAYE----G---------- 203

  Fly   387 VTQLLRIGKNIDFYFHAGESRCPDSSRPDANLLEAL-LLQSKRIGNAVNLPFHPEIMKVMKRLSI 450
                 .:...|....||||...|:..|      ||: :|:::|:|:..:......:...:.:.::
Mouse   204 -----AVKNGIHRTVHAGEVGSPEVVR------EAVDILKTERVGHGYHTIEDEALYNRLLKENM 257

  Fly   451 AVEICPLSNHYLQYFND--------FRQHPAAYLIAAGFPIV----IGSDYPCFWNSAPLTDDFY 503
            ..|:||.|::....::.        |:...|.|.:....|::    :.:||.........|::.:
Mouse   258 HFEVCPWSSYLTGAWDPKTTHAVVRFKNDKANYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEF 322

  Fly   504 VAFVGVISGWGDLRLLKQFALNSFLFSSLSETEK 537
                            |:..:|:...|.|.|.||
Mouse   323 ----------------KRLNINAAKSSFLPEEEK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-A2NP_525020.2 A_deaminase_N 52..152 CDD:285627
adm_rel 83..556 CDD:273620 57/294 (19%)
ADGF 135..548 CDD:238646 57/294 (19%)
AdaNP_001258981.1 ADA 8..336 CDD:238645 53/288 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.