DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-A2 and ADA

DIOPT Version :9

Sequence 1:NP_525020.2 Gene:Adgf-A2 / 64879 FlyBaseID:FBgn0043025 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_000013.2 Gene:ADA / 100 HGNCID:186 Length:363 Species:Homo sapiens


Alignment Length:299 Identity:59/299 - (19%)
Similarity:105/299 - (35%) Gaps:98/299 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 DGVHYVELRSSLPNMY-----------DLDGNNFTILETAEALVSVSNIFKNSFKDFIGIKLIYA 339
            :||.|||:|.| |::.           ..:|:    |...|.:..|....:...:|| |:|    
Human    93 EGVVYVEVRYS-PHLLANSKVEPIPWNQAEGD----LTPDEVVALVGQGLQEGERDF-GVK---- 147

  Fly   340 PSRNLNDSRMDEYLENARLL---KLHFPNF---------------FAGFDLNTFGDECNLP---L 383
                            ||.:   ..|.||:               ....||  .||| .:|   |
Human   148 ----------------ARSILCCMRHQPNWSPKVVELCKKYQQQTVVAIDL--AGDE-TIPGSSL 193

  Fly   384 LENVTQLLR--IGKNIDFYFHAGESRCPDSSRPDANLLEAL-LLQSKRIGNAVNLPFHPEIMKVM 445
            |....|..:  :...|....||||....:..:      ||: :|:::|:|:..:......:...:
Human   194 LPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVK------EAVDILKTERLGHGYHTLEDQALYNRL 252

  Fly   446 KRLSIAVEICPLSNHYLQYFNDFRQH--------PAAYLIAAGFPIV----IGSDYPCFWNSAPL 498
            ::.::..||||.|::....:....:|        .|.|.:....|::    :.:||.........
Human   253 RQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGF 317

  Fly   499 TDDFYVAFVGVISGWGDLRLLKQFALNSFLFSSLSETEK 537
            |::.:                |:..:|:...|.|.|.||
Human   318 TEEEF----------------KRLNINAAKSSFLPEDEK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-A2NP_525020.2 A_deaminase_N 52..152 CDD:285627
adm_rel 83..556 CDD:273620 59/299 (20%)
ADGF 135..548 CDD:238646 59/299 (20%)
ADANP_000013.2 metallo-dependent_hydrolases 9..347 CDD:320877 59/299 (20%)
Required for binding to DDP4. /evidence=ECO:0000269|PubMed:15016824 126..143 2/16 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.