DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpx and cplx4b

DIOPT Version :9

Sequence 1:NP_001262248.1 Gene:cpx / 64877 FlyBaseID:FBgn0041605 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001162618.1 Gene:cplx4b / 797490 ZFINID:ZDB-GENE-070705-157 Length:126 Species:Danio rerio


Alignment Length:120 Identity:33/120 - (27%)
Similarity:54/120 - (45%) Gaps:30/120 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMRQDIRDKYNIKKK------------ 80
            ||..:|:.||.::   :.::|..:|..|...| :.||..:|..:|:||.|.|.            
Zfish     4 DGMSREEYEEYQK---QMVEEKMERDAEFATK-KAERACLRTCLREKYRIPKSEQDEIMLQQAGD 64

  Fly    81 -----EEIVE----AAPQEEPNP-LMRKKKTPEEL----AAEAEQEELDDFTSKS 121
                 ||:|:    .|||||.|| :|.:.:..:.:    ..|..|..|.:..||:
Zfish    65 DIDVPEELVKMVDGEAPQEEENPSIMAQMQNLQNMDVGQLKEKAQATLVEMKSKA 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpxNP_001262248.1 Synaphin 2..124 CDD:283491 33/120 (28%)
cplx4bNP_001162618.1 Synaphin <4..106 CDD:283491 28/105 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.