DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpx and Cplx1

DIOPT Version :9

Sequence 1:NP_001262248.1 Gene:cpx / 64877 FlyBaseID:FBgn0041605 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_074055.1 Gene:Cplx1 / 64832 RGDID:70944 Length:134 Species:Rattus norvegicus


Alignment Length:140 Identity:57/140 - (40%)
Similarity:74/140 - (52%) Gaps:15/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMR 68
            |:.||.:|.....:...:|||...|.|    |.::|.|||||:::||:.||.|:.|||.|||.||
  Rat     3 FVMKQALGGATKDMGKMLGGDEEKDPD----AAKKEEERQEALRQAEEERKAKYAKMEAEREVMR 63

  Fly    69 QDIRDKYNIKKKEE-IVEAAPQEEPN---PLMRKKKT-PEELAAEAEQEELDDFTSKSLLPLSSA 128
            |.|||||.|||||| ..||....|.|   .|.|.||. |.....|.|:|:      :|:|.....
  Rat    64 QGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEPEEED------ESILDTVIK 122

  Fly   129 VEPGSASGIY 138
            ..||....::
  Rat   123 YLPGPLQDMF 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpxNP_001262248.1 Synaphin 2..124 CDD:283491 54/124 (44%)
Cplx1NP_074055.1 Synaphin 1..133 CDD:399088 57/140 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60 25/60 (42%)
Interaction with the SNARE complex 48..70 15/21 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..114 16/45 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348906
Domainoid 1 1.000 83 1.000 Domainoid score I8167
eggNOG 1 0.900 - - E1_2CF74
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5091
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46406
orthoMCL 1 0.900 - - OOG6_108742
Panther 1 1.100 - - O PTHR16705
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2910
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.750

Return to query results.
Submit another query.