DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpx and CPLX3

DIOPT Version :9

Sequence 1:NP_001262248.1 Gene:cpx / 64877 FlyBaseID:FBgn0041605 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001025176.1 Gene:CPLX3 / 594855 HGNCID:27652 Length:158 Species:Homo sapiens


Alignment Length:132 Identity:44/132 - (33%)
Similarity:62/132 - (46%) Gaps:21/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFIAKQMVGNQLSAVKGAVGGDGGDDGD-DKEKAE------EEERERQEAIKEAEDRRKEKHRKM 60
            ||:.|.|||.||..:.|::|| |.|.|| ||..||      ||..|.|:.:.|.:..|..:..:.
Human     2 AFMVKTMVGGQLKNLTGSLGG-GEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQR 65

  Fly    61 EEEREKMRQDIRDKYNIKKKE----EIVEAAPQEEPNPLMRKKKTPEELAAEAEQEELDDFTSKS 121
            :.||..:|...||||.:.|.|    :|..|....|         .|.|||...|::..::....|
Human    66 KAERATLRSHFRDKYRLPKNETDESQIQMAGGDVE---------LPRELAKMIEEDTEEEEEKAS 121

  Fly   122 LL 123
            :|
Human   122 VL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpxNP_001262248.1 Synaphin 2..124 CDD:283491 44/132 (33%)
CPLX3NP_001025176.1 Synaphin 1..139 CDD:310434 44/132 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..47 14/34 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..99 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.