DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpx and LOC563082

DIOPT Version :9

Sequence 1:NP_001262248.1 Gene:cpx / 64877 FlyBaseID:FBgn0041605 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_005173398.1 Gene:LOC563082 / 563082 -ID:- Length:134 Species:Danio rerio


Alignment Length:126 Identity:52/126 - (41%)
Similarity:66/126 - (52%) Gaps:9/126 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMR 68
            |:.||.:|.....:...:||:...|.|    ||.:|.|||||:::.|:.||.|:.|||.|||.:|
Zfish     3 FVMKQALGGATKDMGKMLGGEEEKDPD----AERKEEERQEALRQQEEERKAKYAKMEAERESVR 63

  Fly    69 QDIRDKYNIKKKE----EIVEAAPQEEPNPLMRKKKT-PEELAAEAEQEELDDFTSKSLLP 124
            |.|||||.|||||    |...|..|.....|.|.||. |.....:.|:||....|....||
Zfish    64 QGIRDKYGIKKKEEKEAEAAAALEQAAEGSLTRPKKAIPAGCGDDEEEEESIVDTVMKFLP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpxNP_001262248.1 Synaphin 2..124 CDD:283491 50/124 (40%)
LOC563082XP_005173398.1 Synaphin 1..132 CDD:283491 52/126 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590062
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2464
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.