DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpx and Cplx3

DIOPT Version :9

Sequence 1:NP_001262248.1 Gene:cpx / 64877 FlyBaseID:FBgn0041605 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_666335.1 Gene:Cplx3 / 235415 MGIID:2384571 Length:158 Species:Mus musculus


Alignment Length:130 Identity:46/130 - (35%)
Similarity:61/130 - (46%) Gaps:23/130 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFIAKQMVGNQLSAVKGAVGGDGGDDGD-DKEKAE------EEERERQEAIKEAEDRRKEKHRKM 60
            ||:.|.|||.||..:.|::|| |.|.|| ||..||      ||..|.|:.:.|.:..|..:..:.
Mouse     2 AFMVKSMVGGQLKNLTGSLGG-GEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQR 65

  Fly    61 EEEREKMRQDIRDKYNIKKKE----EIVEAAPQEEPNPLMRKKKTPEELA--AEAEQEELDDFTS 119
            :.||..:|...||||.:.|.|    :|..|....|         .|.|||  .|.:.||.:|..|
Mouse    66 KAERATLRSHFRDKYRLPKNETDESQIQLAGGDVE---------LPRELAKMIEEDTEEEEDKAS 121

  Fly   120  119
            Mouse   122  121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpxNP_001262248.1 Synaphin 2..124 CDD:283491 46/130 (35%)
Cplx3NP_666335.1 Synaphin 1..139 CDD:399088 46/130 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..47 13/33 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.