DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpx and Cplx2

DIOPT Version :9

Sequence 1:NP_001262248.1 Gene:cpx / 64877 FlyBaseID:FBgn0041605 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001349147.1 Gene:Cplx2 / 12890 MGIID:104726 Length:134 Species:Mus musculus


Alignment Length:140 Identity:55/140 - (39%)
Similarity:76/140 - (54%) Gaps:15/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMR 68
            |:.||.:|.....:...:||:...|.|    |:::|.|||||:::.|:.||.||.:||.||||:|
Mouse     3 FVMKQALGGATKDMGKMLGGEEEKDPD----AQKKEEERQEALRQQEEERKAKHARMEAEREKVR 63

  Fly    69 QDIRDKYNIKKKE--EIVEAAPQEEP--NPLMRKKKT-PEELAAEAEQEELDDFTSKSLLPLSSA 128
            |.|||||.:||||  |..|.|..|:|  ..|.|.||. |.....|.|:||      :|:|.....
Mouse    64 QQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEE------ESILDTVLK 122

  Fly   129 VEPGSASGIY 138
            ..||....::
Mouse   123 YLPGPLQDMF 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpxNP_001262248.1 Synaphin 2..124 CDD:283491 52/124 (42%)
Cplx2NP_001349147.1 Synaphin 1..133 CDD:399088 55/140 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 51/120 (43%)
Interaction with the SNARE complex. /evidence=ECO:0000250 41..97 28/55 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845494
Domainoid 1 1.000 83 1.000 Domainoid score I8355
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5173
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44305
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16705
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2464
SonicParanoid 1 1.000 - - X2910
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.980

Return to query results.
Submit another query.