DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpx and Cplx2

DIOPT Version :9

Sequence 1:NP_001262248.1 Gene:cpx / 64877 FlyBaseID:FBgn0041605 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_446330.1 Gene:Cplx2 / 116657 RGDID:70945 Length:134 Species:Rattus norvegicus


Alignment Length:140 Identity:55/140 - (39%)
Similarity:76/140 - (54%) Gaps:15/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMR 68
            |:.||.:|.....:...:||:...|.|    |:::|.|||||:::.|:.||.||.:||.||||:|
  Rat     3 FVMKQALGGATKDMGKMLGGEEEKDPD----AQKKEEERQEALRQQEEERKAKHARMEAEREKVR 63

  Fly    69 QDIRDKYNIKKKE--EIVEAAPQEEP--NPLMRKKKT-PEELAAEAEQEELDDFTSKSLLPLSSA 128
            |.|||||.:||||  |..|.|..|:|  ..|.|.||. |.....|.|:||      :|:|.....
  Rat    64 QQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEE------ESILDTVLK 122

  Fly   129 VEPGSASGIY 138
            ..||....::
  Rat   123 YLPGPLQDMF 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpxNP_001262248.1 Synaphin 2..124 CDD:283491 52/124 (42%)
Cplx2NP_446330.1 Synaphin 1..133 CDD:399088 55/140 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 51/120 (43%)
Interaction with the SNARE complex 41..97 28/55 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348907
Domainoid 1 1.000 83 1.000 Domainoid score I8167
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5091
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46406
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16705
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2910
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.950

Return to query results.
Submit another query.