DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpx and CPLX1

DIOPT Version :9

Sequence 1:NP_001262248.1 Gene:cpx / 64877 FlyBaseID:FBgn0041605 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_006642.1 Gene:CPLX1 / 10815 HGNCID:2309 Length:134 Species:Homo sapiens


Alignment Length:134 Identity:56/134 - (41%)
Similarity:72/134 - (53%) Gaps:15/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMR 68
            |:.||.:|.....:...:|||...|.|    |.::|.|||||:::||:.||.|:.|||.|||.:|
Human     3 FVMKQALGGATKDMGKMLGGDEEKDPD----AAKKEEERQEALRQAEEERKAKYAKMEAEREAVR 63

  Fly    69 QDIRDKYNIKKKEE-IVEAAPQEEPN---PLMRKKKT-PEELAAEAEQEELDDFTSKSLLPLSSA 128
            |.|||||.|||||| ..||....|.|   .|.|.||. |.....|.|:|:      :|:|.....
Human    64 QGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEED------ESILDTVIK 122

  Fly   129 VEPG 132
            ..||
Human   123 YLPG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpxNP_001262248.1 Synaphin 2..124 CDD:283491 53/124 (43%)
CPLX1NP_006642.1 Synaphin 1..133 CDD:310434 56/134 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60 25/60 (42%)
Interaction with the SNARE complex. /evidence=ECO:0000250 48..70 14/21 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..113 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155031
Domainoid 1 1.000 83 1.000 Domainoid score I8364
eggNOG 1 0.900 - - E1_2CF74
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5190
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42252
orthoMCL 1 0.900 - - OOG6_108742
Panther 1 1.100 - - O PTHR16705
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4999
SonicParanoid 1 1.000 - - X2910
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.