DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpx and cplx1

DIOPT Version :9

Sequence 1:NP_001262248.1 Gene:cpx / 64877 FlyBaseID:FBgn0041605 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001096263.1 Gene:cplx1 / 100124828 XenbaseID:XB-GENE-5815523 Length:133 Species:Xenopus tropicalis


Alignment Length:116 Identity:51/116 - (43%)
Similarity:63/116 - (54%) Gaps:11/116 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMR 68
            |:.||.:|.....:...:|||...|.|.::|.|    |.|||:::.||.||.|:.|||.|||.||
 Frog     3 FVMKQALGGATKDMGKMLGGDEEKDPDAQKKME----EAQEALRQQEDERKAKYAKMEAEREIMR 63

  Fly    69 QDIRDKYNIKKKEEIVEAAPQ------EEPNPLMRKKKTPEELAAEAEQEE 113
            |.|||||.|||||| .||..|      .|.:....||..|.....|.|:||
 Frog    64 QGIRDKYGIKKKEE-KEAEAQAAMEATSEGSLTRPKKAIPAGCGDEEEEEE 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpxNP_001262248.1 Synaphin 2..124 CDD:283491 51/116 (44%)
cplx1NP_001096263.1 Synaphin 1..132 CDD:399088 51/116 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8234
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5025
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49482
Panther 1 1.100 - - O PTHR16705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2910
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.