DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpx and cplx4c

DIOPT Version :9

Sequence 1:NP_001262248.1 Gene:cpx / 64877 FlyBaseID:FBgn0041605 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001165062.1 Gene:cplx4c / 100004361 ZFINID:ZDB-GENE-101018-1 Length:157 Species:Danio rerio


Alignment Length:127 Identity:45/127 - (35%)
Similarity:65/127 - (51%) Gaps:22/127 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFIAKQMVGNQLSAVKGAVGGDG--GDDGDDKEKA-------EEEERERQEAIKEAEDRRKEKHR 58
            ||:.:||:|::|   |...||:.  .:||..||.|       ||.|..:::.|:|...|.||...
Zfish     2 AFLLQQMLGDKL---KNMTGGNSEEDEDGGGKETAASKGMSREEFEEYQKQLIEEKIARDKEFAT 63

  Fly    59 KMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKKKTPEELA----AEAEQEELDD 116
            | :.||..:|..:||||.:.:..: .:|..|...:.|    ..|||||    .|.|||||:|
Zfish    64 K-KAERANLRVLLRDKYRLPQSAQ-DDATVQMAGDDL----DIPEELAKMVDEEEEQEELND 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpxNP_001262248.1 Synaphin 2..124 CDD:283491 45/127 (35%)
cplx4cNP_001165062.1 Synaphin 1..136 CDD:283491 45/127 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.