DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment disco-r and CG8089

DIOPT Version :9

Sequence 1:NP_001259598.1 Gene:disco-r / 64875 FlyBaseID:FBgn0285879 Length:1311 Species:Drosophila melanogaster
Sequence 2:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster


Alignment Length:165 Identity:37/165 - (22%)
Similarity:65/165 - (39%) Gaps:42/165 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   989 REPEPETEIEPEHEHEHEPEPETEV-------------EVPEVPIDKENPLKCTACGEIFQNHFH 1040
            |||       |:.....:|.|..::             .:.:..::|.| ..|..||..|.:...
  Fly   417 REP-------PKGGCRKQPTPVCKICNRKFTRKFFLEEHMNKAHLNKRN-FTCEICGANFYSQGT 473

  Fly  1041 LKTHHQSVHLKLHH-KCNIDGCNAAFPSKRSRDRHSSNLNLHRKLL--------STSDDHGLLHA 1096
            ::||.::|||.:|. :|.:  |:....||.:..||..:.: |:..|        .|.|.:....|
  Fly   474 MQTHRKAVHLLVHTVQCEV--CDLTIKSKGNYRRHCKSQS-HKDNLVKFGKNNDKTKDSNRRKGA 535

  Fly  1097 PVMPATDPLLELMSLNLNN------NKSGFHHSAM 1125
               ..||..|::.:.:..|      |||..::..|
  Fly   536 ---RTTDEKLDIEASSSTNTCMTSANKSTHNYKKM 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
disco-rNP_001259598.1 C2H2 Zn finger 1028..1053 CDD:275370 9/24 (38%)
C2H2 Zn finger 1056..1083 CDD:275370 7/26 (27%)
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368
C2H2 Zn finger 322..343 CDD:275368
C2H2 Zn finger 355..376 CDD:275368
C2H2 Zn finger 432..453 CDD:275368 0/20 (0%)
C2H2 Zn finger 461..486 CDD:275368 9/24 (38%)
C2H2 Zn finger 490..506 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7987
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.