DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment disco-r and LOC100536790

DIOPT Version :9

Sequence 1:NP_001259598.1 Gene:disco-r / 64875 FlyBaseID:FBgn0285879 Length:1311 Species:Drosophila melanogaster
Sequence 2:XP_009295450.1 Gene:LOC100536790 / 100536790 -ID:- Length:523 Species:Danio rerio


Alignment Length:255 Identity:85/255 - (33%)
Similarity:116/255 - (45%) Gaps:71/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 SASGSCSSSQRMTRLA-----LSSNMRSSRKTP--HSPGGGGAGGNGGSVGGGGGKRQWGSMPAN 460
            |...:....|::.||:     .:|.:..|.|.|  |:.|...:|.:.|:       ::..|:   
Zfish   229 SPHSAAPEHQKLQRLSKHSRRSTSQLACSTKPPKRHAEGDSPSGDSSGT-------QERSSL--- 283

  Fly   461 LGTQFINPVTGKKRVQCNVCLKTFCDKGALKIHFSAVHLREMHKCTVDGCSMMFSSRRSRNRHSA 525
                      .|.||.|:.|.|||.|||.|||||:||||:..|:||||||:|||||.||||||||
Zfish   284 ----------SKGRVSCDACAKTFYDKGTLKIHFNAVHLKIKHRCTVDGCNMMFSSLRSRNRHSA 338

  Fly   526 NPNPKLH--SPHLRRKISPHDGRSAQP--HPLLLQAPNGLMAGLAPFGSFPLLTPP----PD--- 579
            ||||:||  :.|..|:.      :|||  |.|.|...:..||.::        |.|    ||   
Zfish   339 NPNPRLHAAAEHAVRRF------TAQPRHHVLRLNTSHVSMATVS--------TEPQKQRPDTCE 389

  Fly   580 LRHHAMGGSGAGSGAGVGALELKHGQDYLQRSYLDAGRFEGQRRKLAMENEHTEDEDDDE 639
            :...||..| |.....:.....|                  :.||.:...:...|||||:
Zfish   390 ISGRAMNCS-ANQNEPINVTPKK------------------KSRKSSTPLKIRRDEDDDD 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
disco-rNP_001259598.1 C2H2 Zn finger 1028..1053 CDD:275370
C2H2 Zn finger 1056..1083 CDD:275370
LOC100536790XP_009295450.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D59377at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.