DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2D and Mcts2

DIOPT Version :9

Sequence 1:NP_477481.1 Gene:eIF2D / 64874 FlyBaseID:FBgn0041588 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_079819.1 Gene:Mcts2 / 66405 MGIID:1913655 Length:181 Species:Mus musculus


Alignment Length:184 Identity:49/184 - (26%)
Similarity:82/184 - (44%) Gaps:15/184 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLKPYRPKSSAA----LKGSDSKKFRQRVEAAFPHVS--VDQLVPAKAAVTQVKILTHGGVQSM 59
            || |.:..|.|.:    ||.|..|..:.::...||.:.  ::|::|.|..|..|:...|    ..
Mouse     1 MF-KKFDEKESVSNCIQLKTSVIKGIKSQLTEQFPGIEPWLNQIMPKKDPVKIVRCHEH----ME 60

  Fly    60 VYCVDKLPLFFELDGGQLVPTLYTLWIVPDILPYFTTHEGVLPKLTNGADLMLPGVVPLGVGLSM 124
            :..|:...|||....|...|||..|...|.|||:....:|.:..:.:||::|.||:...|..|..
Mouse    61 ILTVNGELLFFRQRKGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYT 125

  Fly   125 YGHFKKGQLMAVNLTNNKSAVGVGQLARSSDELYMCGGHGVAIKMLHLFGDKLW 178
            ..   ...::||.....:.|:.||.:..::.::... ..|:.|:.:|...|.||
Mouse   126 AA---VDTIVAVMAEGKEHALCVGVMKMAAADIEKI-NKGIGIENIHYLNDGLW 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2DNP_477481.1 eIF2D_N 6..79 CDD:211423 19/78 (24%)
Tma20 9..178 CDD:224927 44/174 (25%)
PUA 61..175 CDD:294405 29/113 (26%)
eIF2D_C 469..551 CDD:211321
Mcts2NP_079819.1 MCT1_N 4..80 CDD:211422 19/79 (24%)
PUA_MCTS-1-like 80..175 CDD:409297 25/98 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2016
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.