DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2D and mcts1

DIOPT Version :9

Sequence 1:NP_477481.1 Gene:eIF2D / 64874 FlyBaseID:FBgn0041588 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001006880.1 Gene:mcts1 / 448679 XenbaseID:XB-GENE-998581 Length:181 Species:Xenopus tropicalis


Alignment Length:190 Identity:50/190 - (26%)
Similarity:83/190 - (43%) Gaps:27/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLKPYRPKSSAA----LKGSDSKKFRQRVEAAFPHVS--VDQLVPAKAAV------TQVKILTH 53
            || |.:..|.:.:    ||.|..|..:.::...||.:.  ::|::|.|..|      ..::|||.
 Frog     1 MF-KKFDEKENVSNCIQLKTSVIKGIKNQLIDQFPVIEQWLNQIMPKKDPVKIVRCHEHIEILTV 64

  Fly    54 GGVQSMVYCVDKLPLFFELDGGQLVPTLYTLWIVPDILPYFTTHEGVLPKLTNGADLMLPGVVPL 118
            .|..          |||....|...|||..|...|.|||:....:|.:..:.:||::|.||:...
 Frog    65 NGEL----------LFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSP 119

  Fly   119 GVGLSMYGHFKKGQLMAVNLTNNKSAVGVGQLARSSDELYMCGGHGVAIKMLHLFGDKLW 178
            |..|....   ...::|:.....:.|:.||.:..|:|::... ..|:.|:.:|...|.||
 Frog   120 GAKLYPAA---ADTVVAIMAEGKQHALCVGVMKMSADDIEKV-NKGIGIENIHYLNDGLW 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2DNP_477481.1 eIF2D_N 6..79 CDD:211423 19/84 (23%)
Tma20 9..178 CDD:224927 45/180 (25%)
PUA 61..175 CDD:294405 29/113 (26%)
eIF2D_C 469..551 CDD:211321
mcts1NP_001006880.1 MCT1_N 4..80 CDD:211422 19/85 (22%)
Tma20 23..177 CDD:224927 43/167 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.