DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2D and MCTS1

DIOPT Version :9

Sequence 1:NP_477481.1 Gene:eIF2D / 64874 FlyBaseID:FBgn0041588 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001245541.1 Gene:MCTS1 / 31536 FlyBaseID:FBgn0029833 Length:182 Species:Drosophila melanogaster


Alignment Length:201 Identity:52/201 - (25%)
Similarity:84/201 - (41%) Gaps:40/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLKPYRPKSSAA----LKGSDSKKFRQRVEAAFPHVS--VDQLVPAKAAVTQVKILTHGGVQSM 59
            || |.:..|.|.:    ||.|..|..|.::..|:|.:.  :|.::|.|.:....|          
  Fly     1 MF-KKFEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLESHIDLILPKKDSYRIAK---------- 54

  Fly    60 VYCVDKLPL---------FFELDGGQLVPTLYTLWIVPDILPYFTT----HEGVLPKLTNGADLM 111
              |.|.:.|         ||....|..:|||..|    ...|||.|    .:|.:..:.:||::|
  Fly    55 --CHDHIELLLNGAGDQVFFRHRDGPWMPTLRLL----HKFPYFVTMQQVDKGAIRFVLSGANVM 113

  Fly   112 LPGVVPLGVGLSMYGHFKKGQLMAVNLTNNKSAVGVGQLARSSDELYMCGGHGVAIKMLHLFGDK 176
            .||:...|..::   ...|..::|:.....:.|:.||.|..|:.|: :....|:.|:..|...|.
  Fly   114 CPGLTSPGACMT---PADKDTVVAIMAEGKEHALAVGLLTLSTQEI-LAKNKGIGIETYHFLNDG 174

  Fly   177 LWSHEP 182
            ||..:|
  Fly   175 LWKSKP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2DNP_477481.1 eIF2D_N 6..79 CDD:211423 19/87 (22%)
Tma20 9..178 CDD:224927 46/187 (25%)
PUA 61..175 CDD:294405 32/126 (25%)
eIF2D_C 469..551 CDD:211321
MCTS1NP_001245541.1 MCT1_N 4..81 CDD:211422 19/88 (22%)
Tma20 18..177 CDD:224927 44/178 (25%)
PUA 69..173 CDD:294405 29/111 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2016
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.