DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2D and Mcts1

DIOPT Version :9

Sequence 1:NP_477481.1 Gene:eIF2D / 64874 FlyBaseID:FBgn0041588 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001037702.1 Gene:Mcts1 / 302500 RGDID:1566390 Length:182 Species:Rattus norvegicus


Alignment Length:173 Identity:45/173 - (26%)
Similarity:76/173 - (43%) Gaps:22/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LKGSDSKKFRQRVEAAFPHVS--VDQLVPAKAAV------TQVKILTHGGVQSMVYCVDKLPLFF 70
            ||.|..|..:.::...||.:.  ::|::|.|..|      ..::|||..|..          |||
  Rat    18 LKTSVIKGIKNQLLEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGEL----------LFF 72

  Fly    71 ELDGGQLVPTLYTLWIVPDILPYFTTHEGVLPKLTNGADLMLPGVVPLGVGLSMYGHFKKGQLMA 135
            ....|...|||..|...|.|||:....:|.:..:.:||::|.||:...|..|....   ...::|
  Rat    73 RQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAA---VDTIVA 134

  Fly   136 VNLTNNKSAVGVGQLARSSDELYMCGGHGVAIKMLHLFGDKLW 178
            :.....:.|:.||.:..|::::... ..|:.|:.:|...|.||
  Rat   135 IMAEGKQHALCVGVMKMSAEDIEKV-NKGIGIENIHYLNDGLW 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2DNP_477481.1 eIF2D_N 6..79 CDD:211423 18/72 (25%)
Tma20 9..178 CDD:224927 43/171 (25%)
PUA 61..175 CDD:294405 28/113 (25%)
eIF2D_C 469..551 CDD:211321
Mcts1NP_001037702.1 MCT1_N 5..81 CDD:211422 18/72 (25%)
PUA_MCTS-1-like 81..176 CDD:409297 25/98 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2016
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.