DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2D and C11D2.7

DIOPT Version :9

Sequence 1:NP_477481.1 Gene:eIF2D / 64874 FlyBaseID:FBgn0041588 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_741412.1 Gene:C11D2.7 / 177377 WormBaseID:WBGene00015703 Length:185 Species:Caenorhabditis elegans


Alignment Length:177 Identity:47/177 - (26%)
Similarity:80/177 - (45%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LKGSDSKKFRQRVEAAFPHVS--VDQLVPAKAAVTQVKILTHGGVQSMVYCVDKLPL-------- 68
            ||.|..|..|:::...||::.  :::::|.|.....:|            |.|.:.|        
 Worm    17 LKSSVQKGIRKKLIENFPYLEPHLEEILPKKENFKVIK------------CKDHIELLADHLGVV 69

  Fly    69 -FFELDGGQLVPTLYTLWIVPDILPYFTTHEGVLPKLTNGADLMLPGVVPLGVGLSMYGHFKKGQ 132
             |.:......:|||.||...|.|||:....:|.:..:.||:.:|.||:...|..|:..  ..|..
 Worm    70 RFVKTRNTDYIPTLRTLHKYPFILPHQQVDKGAIKFILNGSSIMCPGLTSPGAKLTPL--VPKDS 132

  Fly   133 LMAVNLTNNKSAVGVGQLARSSDELYMCG-GHGVAIKMLHLFGDKLW 178
            ::||.....:.|:.:|.::.||:|:.... |:|  |:.||...|.||
 Worm   133 VVAVMAEGKQHALAIGLMSMSSEEIQSVNKGNG--IENLHYLNDGLW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2DNP_477481.1 eIF2D_N 6..79 CDD:211423 14/75 (19%)
Tma20 9..178 CDD:224927 45/175 (26%)
PUA 61..175 CDD:294405 34/123 (28%)
eIF2D_C 469..551 CDD:211321
C11D2.7NP_741412.1 MCT1_N 4..81 CDD:211422 14/75 (19%)
Tma20 18..177 CDD:224927 44/174 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2016
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.