DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment MESK4 and ALDH1A2

DIOPT Version :9

Sequence 1:	NP_001262650.1	Gene:	MESK4 / 64872	FlyBaseID:	FBgn0043069	Length:	280	Species:	Drosophila melanogaster
Sequence 2:	NP_003879.2	Gene:	ALDH1A2 / 8854	HGNCID:	15472	Length:	518	Species:	Homo sapiens

Alignment Length:	173	Identity:	35/173 - (20%)
Similarity:	40/173 - (23%)	Gaps:	104/173 - (60%)

- Green bases have known domain annotations that are detailed below.

  Fly   102 RLADKFAAQTKFLDLSHNDFRNLR----------FL-SFFEDLDTLILDRNVNLDINTFPYLPSL 155
            ||.||.|      ||...|...|.          || :|:.||..:         |.||.|
Human   104 RLLDKLA------DLVERDRAVLATMESLNGGKPFLQAFYVDLQGV---------IKTFRY---- 149

  Fly   156 RILWINNCDIANITDWIH-----------RIERH-----------------------CPALDQLS 186
                     .|...|.||           ...||                       .|||
Human   150 ---------YAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPAL---- 201

  Fly   187 CMGN---------------------------PGIRTVFGGQGP 202
            |.||                           ||:..:..|.||
Human   202 CCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGP 244

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
MESK4	NP_001262650.1	leucine-rich repeat	111..132	CDD:275378	7/31 (23%)
		leucine-rich repeat	133..154	CDD:275378	5/20 (25%)
		leucine-rich repeat	155..181	CDD:275378	6/59 (10%)
ALDH1A2	NP_003879.2	ALDH_F1AB_F2_RALDH1	32..512	CDD:143459	35/173 (20%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1012
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900