DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESK4 and MSC7

DIOPT Version :9

Sequence 1:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_011904.1 Gene:MSC7 / 856434 SGDID:S000001081 Length:644 Species:Saccharomyces cerevisiae


Alignment Length:109 Identity:28/109 - (25%)
Similarity:44/109 - (40%) Gaps:30/109 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IQSLESLNYEYNDVLLTEDNVGKMITPNPYSFSGNISISSCPSEDVSFS------------ESIL 83
            |.|:.|.||.::::|      |.:|..   .|:||..:..| ||.|.:|            |:..
Yeast   241 ISSIVSWNYPFHNLL------GPIIAA---LFTGNAIVVKC-SEQVVWSSEFFVELIRKCLEACD 295

  Fly    84 EDNGRISLAYENLKTIPRRLADKFAAQTKFLDLSHNDFRNLRFL 127
            ||...:.|.|....|.....|:.|.        ||..|:::.|:
Yeast   296 EDPDLVQLCYCLPPTENDDSANYFT--------SHPGFKHITFI 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378 4/17 (24%)
leucine-rich repeat 133..154 CDD:275378
leucine-rich repeat 155..181 CDD:275378
MSC7NP_011904.1 ALDH_F15-22 115..590 CDD:143416 28/109 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.