DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESK4 and LRMDA

DIOPT Version :9

Sequence 1:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001292510.1 Gene:LRMDA / 83938 HGNCID:23405 Length:226 Species:Homo sapiens


Alignment Length:228 Identity:61/228 - (26%)
Similarity:88/228 - (38%) Gaps:54/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RISLAYENLKTIPRRLADKFAAQTKFLDLSHNDFRNLRFLSFFEDLDTLILDRNVNLDINTFPYL 152
            ::|...::.:.||..|........|.||||.|..|:|..||.|..|:.||||.|...|....|.|
Human    10 QVSYIGQDCREIPEHLGRDCGHFAKRLDLSFNLLRSLEGLSAFRSLEELILDNNQLGDDLVLPGL 74

  Fly   153 PSLRILWINNCDIANITDWIHRIERHCPALDQLSCMGNPGIRTVFGGQGPRE------------- 204
            |.|..|.:|...|.::.:.:..:....|||:.||.:||...        |.|             
Human    75 PRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVAC--------PNELVSLEKDEEDYKR 131

  Fly   205 ---YILQVLPQLKYLDGLPTSR--------NAAYATLSSSQGQGPDSTSNSEK--PPLASAFTFK 256
               ::|..||.||:||....:|        ...:..:...:....|..|:.|:  .||.||    
Human   132 YRCFVLYKLPNLKFLDAQKVTRQEREEALVRGVFMKVVKPKASSEDVASSPERHYTPLPSA---- 192

  Fly   257 DIIRPKYSRK--SHSGRM-------FGNGSSTN 280
                   ||:  ||.|.:       :|..|..|
Human   193 -------SRELTSHQGVLGKCRYVYYGKNSEGN 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378 11/20 (55%)
leucine-rich repeat 133..154 CDD:275378 9/20 (45%)
leucine-rich repeat 155..181 CDD:275378 4/25 (16%)
LRMDANP_001292510.1 LRR_RI <27..>113 CDD:238064 31/85 (36%)
leucine-rich repeat 34..54 CDD:275378 11/19 (58%)
LRR_8 53..112 CDD:290566 19/58 (33%)
LRR_4 54..93 CDD:289563 14/38 (37%)
leucine-rich repeat 55..76 CDD:275378 9/20 (45%)
leucine-rich repeat 77..103 CDD:275378 4/25 (16%)
leucine-rich repeat 104..142 CDD:275378 9/45 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41579
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.