Sequence 1: | NP_001262650.1 | Gene: | MESK4 / 64872 | FlyBaseID: | FBgn0043069 | Length: | 280 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006519739.1 | Gene: | Lrmda / 76633 | MGIID: | 1923883 | Length: | 239 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 52/196 - (26%) |
---|---|---|---|
Similarity: | 77/196 - (39%) | Gaps: | 44/196 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 RISLAYENLKTIPRRLADKFAAQTKFLDLSHNDFRNLRFLSFFEDLDTLILDRNVNLDINTFPYL 152
Fly 153 PSLRILWINNCDIANITDWIHRIERHCPALDQLSCMGNPGIRTVFGGQGPRE------------- 204
Fly 205 ---YILQVLPQLKYLDGLPTSRNAAYATLSSSQGQGPDSTSNSEKPPLASAFTFKDIIRPKYSRK 266
Fly 267 S 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MESK4 | NP_001262650.1 | leucine-rich repeat | 111..132 | CDD:275378 | 11/20 (55%) |
leucine-rich repeat | 133..154 | CDD:275378 | 9/20 (45%) | ||
leucine-rich repeat | 155..181 | CDD:275378 | 4/25 (16%) | ||
Lrmda | XP_006519739.1 | LRR_9 | 21..159 | CDD:373143 | 46/165 (28%) |
leucine-rich repeat | 34..54 | CDD:275378 | 11/19 (58%) | ||
leucine-rich repeat | 55..76 | CDD:275378 | 9/20 (45%) | ||
leucine-rich repeat | 77..103 | CDD:275378 | 4/25 (16%) | ||
leucine-rich repeat | 104..142 | CDD:275378 | 9/45 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
3 | 2.870 |