DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESK4 and Snrpa1

DIOPT Version :10

Sequence 1:NP_525017.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_067311.4 Gene:Snrpa1 / 68981 MGIID:1916231 Length:255 Species:Mus musculus


Alignment Length:196 Identity:45/196 - (22%)
Similarity:75/196 - (38%) Gaps:54/196 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 DKFAAQTKFLDLSHNDFRNLRFLSFFEDLDTLILDRN------VNLDINTFPYLPSLRILWINNC 163
            |:|.|    :|.|.|:.|.|........|.||:::.|      ..||    ..||.|..|.:.|.
Mouse    42 DQFDA----IDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLD----QALPCLTELILTNN 98

  Fly   164 DIANITDWIHRIE--RHCPALDQLSCMGNPGIRTVFGGQGPREYILQVLPQLKYLD--------- 217
            .:..:.|    ::  ....:|..||.:.||    |...:..|.|::..:||::.||         
Mouse    99 SLVELGD----LDPLASLKSLTYLSILRNP----VTNKKHYRLYVIYKVPQVRVLDFQKVKLKER 155

  Fly   218 -----------GLPTSRNAAY--------ATLSSSQGQGPDSTSNSE--KPPLASAFTFKDIIRP 261
                       |...:::.|.        |.|.:.:.:|..|..:.|  |..:|:|.|..::.|.
Mouse   156 QEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSAGDVEAIKNAIANASTLAEVERL 220

  Fly   262 K 262
            |
Mouse   221 K 221

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
MESK4NP_525017.1 LRR 1..>190 CDD:443914 23/92 (25%)
leucine-rich repeat 111..132 CDD:275378 5/20 (25%)
LRR_9 <114..217 CDD:405295 27/110 (25%)
leucine-rich repeat 133..154 CDD:275378 7/26 (27%)
leucine-rich repeat 155..181 CDD:275378 4/27 (15%)
Snrpa1NP_067311.4 LRR_9 1..175 CDD:405295 33/148 (22%)
LRR 1 20..41