DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESK4 and Aldh3a2

DIOPT Version :9

Sequence 1:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_006246591.1 Gene:Aldh3a2 / 65183 RGDID:61866 Length:584 Species:Rattus norvegicus


Alignment Length:302 Identity:55/302 - (18%)
Similarity:104/302 - (34%) Gaps:88/302 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QSLESLNYEYNDVLLTEDN-VGKMI--------TPNPYSFSG----------NISIS-------- 69
            ::.|.|...::.:|.|.:. |||::        ||......|          ::.::        
  Rat   246 ETTELLRQRFDHILYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDRDCDLDVACRRITWGK 310

  Fly    70 ------SCPSEDVSFSESILED------NGRISLAY-ENLKTIPRRLADKFAAQTKFLDLSHNDF 121
                  :|.:.|....|:.|:|      ...:...| ||:|..|        ...:.::|.|  |
  Rat   311 YMNCGQTCIAPDYILCEASLQDQIVQKIKDTVKDFYGENVKASP--------DYERIINLRH--F 365

  Fly   122 RNLRFL------SFFEDLD--------TLILDRNVNLDI---NTF-PYLPSLRILWINNCDIANI 168
            :.::.|      :|..:.|        |::.|.:.|..:   ..| |.||.:        .:.|:
  Rat   366 KRIKSLLEGQKIAFGGETDEATRYIAPTILTDVDPNSKVMQEEIFGPILPIV--------SVKNV 422

  Fly   169 TDWIHRI-ERHCPALDQLSCMGNPGIRTVF-----GGQGPREYILQVLPQLKYLDGLPTSRNAAY 227
            .:.|:.| :|..|....:....|..|:.|.     ||....:.|:..........|:..|...||
  Rat   423 EEAINFINDREKPLALYIFSHNNKLIKRVIDETSSGGVTGNDVIMHFTVNSLPFGGVGASGMGAY 487

  Fly   228 ATLSSSQGQGPDSTSNSEKPPLASAFTFKDIIRPKYSRKSHS 269
                  .|:....|.:.::|.|......:.:.:.:|...|.|
  Rat   488 ------HGKYSFDTFSHQRPCLLKGLKGESVNKLRYPPNSES 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378 5/26 (19%)
leucine-rich repeat 133..154 CDD:275378 7/32 (22%)
leucine-rich repeat 155..181 CDD:275378 4/26 (15%)
Aldh3a2XP_006246591.1 ALDH_F3AB 82..521 CDD:143450 53/298 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.