Sequence 1: | NP_001262650.1 | Gene: | MESK4 / 64872 | FlyBaseID: | FBgn0043069 | Length: | 280 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_444310.3 | Gene: | Aldh1a3 / 56847 | MGIID: | 1861722 | Length: | 512 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 36/196 - (18%) |
---|---|---|---|
Similarity: | 57/196 - (29%) | Gaps: | 46/196 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 TSTSERSNSEDSPLNPCLTEVLRNCANIQSLESLNYEYNDVLLTED-----NVGKMITPNPYSFS 63
Fly 64 GNISISSCPSEDVSFSESILEDNGRISLAYENLKTIPR-----RLADKFAAQTKFLDLSHNDFRN 123
Fly 124 LRFL-SFFEDLDTLILDRNVNLDINTFPYLPSLRILWINNCDIANITDWIHRIE-RHCPALDQLS 186
Fly 187 C 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MESK4 | NP_001262650.1 | leucine-rich repeat | 111..132 | CDD:275378 | 5/21 (24%) |
leucine-rich repeat | 133..154 | CDD:275378 | 5/20 (25%) | ||
leucine-rich repeat | 155..181 | CDD:275378 | 3/26 (12%) | ||
Aldh1a3 | NP_444310.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | 4/18 (22%) | |
ALDH_F1AB_F2_RALDH1 | 26..506 | CDD:143459 | 31/173 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1012 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |