DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESK4 and CG2336

DIOPT Version :9

Sequence 1:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster


Alignment Length:209 Identity:45/209 - (21%)
Similarity:68/209 - (32%) Gaps:74/209 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EDSPLNPC----LTEVLRN---CANIQSL---ESLNYEYND------------------VLLTED 49
            ||..:| |    |.|.|.:   |..:.:|   ||:..|:.|                  .::|.:
  Fly   108 EDGDIN-CALHYLVESLHDPFACNAVATLFLQESILEEFVDRIRDRLEPLSTDISGHPVYIMTLE 171

  Fly    50 NVG----KMITPNPYSFSGNISISSCPSEDVSFSESILED--NGRISLAYENLKTIPRRLADKFA 108
            .:|    |.|..||.:...|.|    |......|...|.|  .|.|:|             ..|.
  Fly   172 RIGHLQAKRIVGNPKTVPENAS----PMLVYDLSHRYLADGPTGVITL-------------HTFR 219

  Fly   109 AQTKFLDLSHNDFRNLRFLSFFED-----------LDTLILDRN---VNLDINTFPYLPSLRILW 159
            ...:.::|...:..|...:..:.:           |..||...|   |||:..|.|:        
  Fly   220 TMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLIFTINCYYVNLNEITLPF-------- 276

  Fly   160 INNCDIANITDWIH 173
            :.|.:.|.|.|..|
  Fly   277 VCNFNSAKIIDGYH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378 2/20 (10%)
leucine-rich repeat 133..154 CDD:275378 9/23 (39%)
leucine-rich repeat 155..181 CDD:275378 5/19 (26%)
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 45/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.