DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESK4 and P5CDh1

DIOPT Version :9

Sequence 1:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001189159.1 Gene:P5CDh1 / 40434 FlyBaseID:FBgn0037138 Length:574 Species:Drosophila melanogaster


Alignment Length:105 Identity:22/105 - (20%)
Similarity:39/105 - (37%) Gaps:29/105 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 TKFLDLSHN--------DFRNL-RFLSFFEDLDTLILDRNVNLDINTFPYLPSLR---ILWINNC 163
            ||:..:|.|        .:|.: .|::.....:...:..|::       |.|:|.   :|| ...
  Fly   190 TKYQPISENIKVTKNSLRYRGIDGFIAAVSPFNFTAIGGNLS-------YTPALMGNGVLW-KPS 246

  Fly   164 DIANITDW-IHRIERHCPALDQLSCMGNPGIRTVFGGQGP 202
            |.|.:::| |.:|.|.....|        |:.......||
  Fly   247 DTAMLSNWIIFKIMREAGVPD--------GVVNFVPADGP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378 6/29 (21%)
leucine-rich repeat 133..154 CDD:275378 2/20 (10%)
leucine-rich repeat 155..181 CDD:275378 9/29 (31%)
P5CDh1NP_001189159.1 ALDH_F4-17_P5CDH 41..563 CDD:143441 22/105 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.