DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESK4 and aldh9a1b

DIOPT Version :9

Sequence 1:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_009295330.1 Gene:aldh9a1b / 399481 ZFINID:ZDB-GENE-040120-5 Length:539 Species:Danio rerio


Alignment Length:121 Identity:25/121 - (20%)
Similarity:43/121 - (35%) Gaps:36/121 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LNPCLTEVLRNCANIQS----------LESLNYEYNDVLLTEDN---------VGKMITPNPYSF 62
            :.||   ||.:|.:..:          :..|.::..|.:|...|         |........:..
Zfish   418 MTPC---VLDSCTDDMTCVKEEIFGPVMSVLTFDTEDEVLRRANDSDLGLAAGVFTKDVKRAHRV 479

  Fly    63 SGNISISSC--------PSEDVSF----SESILEDNGRISLA-YENLKTIPRRLAD 105
            ..|:...||        |.| |.|    :..|..:||::::. |..|||:...:.|
Zfish   480 IENLQAGSCFINNYNITPVE-VPFGGFKASGIGRENGQVTIEFYSQLKTVVVEMGD 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378
leucine-rich repeat 133..154 CDD:275378
leucine-rich repeat 155..181 CDD:275378
aldh9a1bXP_009295330.1 ALDH_F9_TMBADH 76..533 CDD:143409 24/118 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.