Sequence 1: | NP_001262650.1 | Gene: | MESK4 / 64872 | FlyBaseID: | FBgn0043069 | Length: | 280 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610315.1 | Gene: | U2A / 35713 | FlyBaseID: | FBgn0033210 | Length: | 265 | Species: | Drosophila melanogaster |
Alignment Length: | 198 | Identity: | 47/198 - (23%) |
---|---|---|---|
Similarity: | 64/198 - (32%) | Gaps: | 80/198 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 LDLSHNDFRNLRFLSFFEDLDTLILDRNVNLDINTFPYLPSLRILWINNCDIANITDWIHRIERH 178
Fly 179 CPALDQLSCMGN-----------PG----------IRTVFGGQGPREYILQVLPQLKYLDG---L 219
Fly 220 PTSRNAAYATLSSSQGQGPDSTSNSEKPPLASAFTFKDIIRPKYSRKS----------HSGRMFG 274
Fly 275 NGS 277 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MESK4 | NP_001262650.1 | leucine-rich repeat | 111..132 | CDD:275378 | 7/17 (41%) |
leucine-rich repeat | 133..154 | CDD:275378 | 2/20 (10%) | ||
leucine-rich repeat | 155..181 | CDD:275378 | 7/25 (28%) | ||
U2A | NP_610315.1 | LRR_9 | 1..175 | CDD:258718 | 39/173 (23%) |
leucine-rich repeat | 22..43 | CDD:275380 | |||
LRR_4 | 46..81 | CDD:289563 | 16/55 (29%) | ||
leucine-rich repeat | 46..65 | CDD:275378 | 9/39 (23%) | ||
leucine-rich repeat | 66..89 | CDD:275378 | 7/25 (28%) | ||
leucine-rich repeat | 90..114 | CDD:275378 | 4/23 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45448422 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |