DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESK4 and P5CDh2

DIOPT Version :9

Sequence 1:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_788705.1 Gene:P5CDh2 / 32625 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster


Alignment Length:150 Identity:22/150 - (14%)
Similarity:47/150 - (31%) Gaps:33/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LTEVLRNCANIQSLESL-----------------NYEYNDVLLTEDNVGK----MITPNPYSFSG 64
            :.::..||.|...|..|                 |..|...|:....:.|    .|..|.:.|..
  Fly   203 IRDIQNNCRNSMRLRGLSGFVAAISPFNFTGIAANLAYTPALMGNSVIWKPSDSAILSNYFVFKA 267

  Fly    65 -------NISISSCPSEDVSFSESILEDNGRISLAYENLKTIPRRLADKFAAQTKFLD-----LS 117
                   :..::..|:|:.:|:..:.:......:.:....|:.:.|....|....|..     :.
  Fly   268 LREAGVPDGVVNFVPAEETTFASVVTQHPKLAGINFTGTSTVLKVLWQLVAQNINFYQNYPRLVG 332

  Fly   118 HNDFRNLRFLSFFEDLDTLI 137
            ....:|..|:....:.:|.:
  Fly   333 EGGGKNFHFVHSSAEPETAV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378 3/25 (12%)
leucine-rich repeat 133..154 CDD:275378 1/4 (25%)
leucine-rich repeat 155..181 CDD:275378
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 22/149 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.