DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESK4 and CG31274

DIOPT Version :9

Sequence 1:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster


Alignment Length:280 Identity:280/280 - (100%)
Similarity:280/280 - (100%) Gaps:0/280 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGTSTSERSNSEDSPLNPCLTEVLRNCANIQSLESLNYEYNDVLLTEDNVGKMITPNPYSFSGN 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MSGTSTSERSNSEDSPLNPCLTEVLRNCANIQSLESLNYEYNDVLLTEDNVGKMITPNPYSFSGN 65

  Fly    66 ISISSCPSEDVSFSESILEDNGRISLAYENLKTIPRRLADKFAAQTKFLDLSHNDFRNLRFLSFF 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 ISISSCPSEDVSFSESILEDNGRISLAYENLKTIPRRLADKFAAQTKFLDLSHNDFRNLRFLSFF 130

  Fly   131 EDLDTLILDRNVNLDINTFPYLPSLRILWINNCDIANITDWIHRIERHCPALDQLSCMGNPGIRT 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 EDLDTLILDRNVNLDINTFPYLPSLRILWINNCDIANITDWIHRIERHCPALDQLSCMGNPGIRT 195

  Fly   196 VFGGQGPREYILQVLPQLKYLDGLPTSRNAAYATLSSSQGQGPDSTSNSEKPPLASAFTFKDIIR 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   196 VFGGQGPREYILQVLPQLKYLDGLPTSRNAAYATLSSSQGQGPDSTSNSEKPPLASAFTFKDIIR 260

  Fly   261 PKYSRKSHSGRMFGNGSSTN 280
            ||||||||||||||||||||
  Fly   261 PKYSRKSHSGRMFGNGSSTN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378 20/20 (100%)
leucine-rich repeat 133..154 CDD:275378 20/20 (100%)
leucine-rich repeat 155..181 CDD:275378 25/25 (100%)
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 20/20 (100%)
leucine-rich repeat 133..154 CDD:275378 20/20 (100%)
leucine-rich repeat 155..181 CDD:275378 25/25 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448418
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 1 1.000 - - H43773
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110427
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.