DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESK4 and Aldh1b1

DIOPT Version :9

Sequence 1:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001011975.1 Gene:Aldh1b1 / 298079 RGDID:1306737 Length:519 Species:Rattus norvegicus


Alignment Length:134 Identity:29/134 - (21%)
Similarity:48/134 - (35%) Gaps:28/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YNDVLLT---EDNVGKMITPNPYSFSGNI--SISSCPSEDVSFSESILEDNGRISLAYENLKTIP 100
            ||.:.:.   .|.|.|...|.....:|.:  .::.....||..:.....:..|:...:..:....
  Rat    38 YNQLFINNEWHDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDLAVRAAREAFRLGSPWRRMDASE 102

  Fly   101 R-RLADKFAAQTKFLDLSHNDFRNLRFLSFFEDLD-------TLILDRNVNLD--INTFPYLPSL 155
            | ||.::.|      ||..   |:..:|:..|.||       :.:||    ||  |..:.||...
  Rat   103 RGRLLNRLA------DLVE---RDRVYLASLETLDNGKPFQESYVLD----LDEVIKVYRYLAGW 154

  Fly   156 RILW 159
            ...|
  Rat   155 ADKW 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378 4/20 (20%)
leucine-rich repeat 133..154 CDD:275378 9/29 (31%)
leucine-rich repeat 155..181 CDD:275378 1/5 (20%)
Aldh1b1NP_001011975.1 PLN02466 13..510 CDD:215259 29/134 (22%)
ALDH_F1AB_F2_RALDH1 33..513 CDD:143459 29/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.